PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DS_CC9498D91.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 78aa MW: 8893.04 Da PI: 9.8212 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 69.4 | 4.7e-22 | 6 | 61 | 32 | 87 |
--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS B3 32 esktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 +++ l +ed +g++W+++++y+++s++yvltkGW++Fv+++gL +gD++vF+ + Traes_3DS_CC9498D91.1 6 KGVLLNFEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLGAGDSIVFSCSAY 61 678899*********************************************96543 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 12.647 | 1 | 75 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 3.2E-23 | 4 | 74 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 7.1E-20 | 5 | 65 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 1.15E-19 | 6 | 72 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 5.30E-16 | 12 | 56 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
TTTTGKGVLL NFEDGEGKVW RFRYSYWNSS QSYVLTKGWS RFVREKGLGA GDSIVFSCSA 60 YGQEKQFFID CKKNKTMA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wid_A | 4e-28 | 1 | 69 | 45 | 112 | DNA-binding protein RAV1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK372082 | 1e-103 | AK372082.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2146E06. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020201133.1 | 8e-51 | AP2/ERF and B3 domain-containing protein Os01g0141000-like | ||||
Refseq | XP_020201484.1 | 8e-51 | AP2/ERF and B3 domain-containing protein Os01g0141000-like | ||||
Swissprot | Q9AWS0 | 4e-40 | Y1410_ORYSJ; AP2/ERF and B3 domain-containing protein Os01g0141000 | ||||
TrEMBL | A0A453DVL1 | 5e-51 | A0A453DVL1_AEGTS; Uncharacterized protein | ||||
STRING | Traes_3B_90BE2090B.1 | 9e-52 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP59306 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68840.2 | 2e-29 | related to ABI3/VP1 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|