PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DS_8AF1A10AB.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 82aa MW: 9475.75 Da PI: 11.0795 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.9 | 7.2e-16 | 13 | 57 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky Traes_3DS_8AF1A10AB.1 13 PWTEDEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 57 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.929 | 6 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.24E-18 | 7 | 62 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.5E-18 | 9 | 60 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 7.9E-13 | 10 | 56 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-12 | 10 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-13 | 13 | 57 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.35E-11 | 13 | 58 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
GRTPEQERKK GVPWTEDEHK LFLLGLKKYG KGDWRNISRN FVQTRTPTQV ASHAQKYFIR 60 LSSGGGKDKR RSSIHDITTV HL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK362184 | 1e-127 | AK362184.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2003C15. | |||
GenBank | AK363192 | 1e-127 | AK363192.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013G01. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003568449.1 | 6e-53 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 5e-44 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A287K2Y2 | 7e-54 | A0A287K2Y2_HORVV; Uncharacterized protein | ||||
STRING | MLOC_20277.1 | 1e-54 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7886 | 33 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 6e-28 | Homeodomain-like transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|