PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DS_796E4C73A.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 77aa MW: 9018.2 Da PI: 9.4879 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 50.1 | 4.6e-16 | 13 | 65 | 5 | 57 |
SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS Homeobox 5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 t+ ++ q++ Le+++ + +yp+ e+ +e A+++gLt +qV++WF+ rR ke++ Traes_3DS_796E4C73A.1 13 TKKSPLQIQMLESFYSEVQYPKPEDLTEYAASVGLTYNQVRIWFKERRRKERR 65 567899*********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 14.382 | 6 | 66 | IPR001356 | Homeobox domain |
SMART | SM00389 | 2.9E-14 | 8 | 70 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 4.71E-16 | 8 | 72 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 2.0E-13 | 13 | 65 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-16 | 13 | 73 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 6.93E-11 | 13 | 56 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 77 aa Download sequence Send to blast |
AKGFLAKSDN AGTKKSPLQI QMLESFYSEV QYPKPEDLTE YAASVGLTYN QVRIWFKERR 60 RKERRHMEAA EVHVETQ |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK373981 | 1e-100 | AK373981.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3049P02. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020153547.1 | 5e-45 | homeobox-DDT domain protein RLT3-like isoform X1 | ||||
Refseq | XP_020153548.1 | 5e-45 | homeobox-DDT domain protein RLT3-like isoform X2 | ||||
TrEMBL | A0A446N6P7 | 2e-49 | A0A446N6P7_TRITD; Uncharacterized protein | ||||
STRING | Traes_3DS_796E4C73A.1 | 2e-51 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4556 | 33 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G12750.1 | 3e-11 | Homeodomain-like transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|