PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DL_75F8A05CF.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 132aa MW: 14627.5 Da PI: 10.2386 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.9 | 4.9e-18 | 45 | 88 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg++++eE+ l+vd+++ lG++ W+ Ia++++ gRt++++k++w++ Traes_3DL_75F8A05CF.1 45 RGSFSQEEEALIVDLHRVLGNR-WAQIAKHLP-GRTDNEVKNFWNS 88 89********************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.728 | 1 | 39 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-6 | 25 | 38 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.87E-22 | 25 | 95 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 7.0E-27 | 39 | 95 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.811 | 40 | 94 | IPR017930 | Myb domain |
SMART | SM00717 | 9.8E-17 | 44 | 92 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.3E-16 | 45 | 88 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.81E-12 | 47 | 87 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
LSPKTSWYVR ACGFSAASVP PARLQRCGKS CRLRWINYLR PDLKRGSFSQ EEEALIVDLH 60 RVLGNRWAQI AKHLPGRTDN EVKNFWNSTI KKKLISQAVG SLXXXXXSAD LYYNILDGAG 120 QGIAAAGCAS LN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 9e-27 | 26 | 94 | 40 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK372926 | 1e-108 | AK372926.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3016B12. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004969713.1 | 1e-64 | myb-related protein Hv1 isoform X1 | ||||
Swissprot | Q9SPG3 | 1e-41 | MYB26_ARATH; Transcription factor MYB26 | ||||
TrEMBL | A0A368RAA2 | 3e-63 | A0A368RAA2_SETIT; Uncharacterized protein | ||||
STRING | Traes_3DL_75F8A05CF.1 | 1e-88 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP12813 | 30 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12720.1 | 9e-47 | myb domain protein 67 |
Publications ? help Back to Top | |||
---|---|---|---|
|