PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DL_5C378695E.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | ARF | ||||||||
Protein Properties | Length: 178aa MW: 20366.2 Da PI: 10.5609 | ||||||||
Description | ARF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 59 | 8.6e-19 | 9 | 73 | 33 | 99 |
-SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F + +++ l+++v+r+ Traes_3DL_5C378695E.1 9 SQELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGEDGVLRLGVRRA 73 569************************************************..44899999999986 PP | |||||||
2 | Auxin_resp | 106.8 | 2.4e-35 | 98 | 178 | 1 | 82 |
Auxin_resp 1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 +a+a++ ks+F+++YnPr ++seF+v+++k++++++++ svGmRfkm++e+ed+serr +Gt++g +++dp + ++SkW++L Traes_3DL_5C378695E.1 98 VAQAVAVKSIFHIYYNPRLCESEFIVPYWKFMRSFSQPSSVGMRFKMKYENEDASERRSTGTITGSRESDP-KSHGSKWKCL 178 68999******************************************************************.*********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 12.844 | 1 | 74 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 6.67E-22 | 2 | 84 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 2.17E-14 | 2 | 72 | No hit | No description |
Gene3D | G3DSA:2.40.330.10 | 5.2E-24 | 4 | 76 | IPR015300 | DNA-binding pseudobarrel domain |
SMART | SM01019 | 0.01 | 5 | 74 | IPR003340 | B3 DNA binding domain |
Pfam | PF02362 | 2.7E-16 | 8 | 73 | IPR003340 | B3 DNA binding domain |
Pfam | PF06507 | 4.2E-29 | 98 | 178 | IPR010525 | Auxin response factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009734 | Biological Process | auxin-activated signaling pathway | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
QDYNLQRPSQ ELVAKDLHGT EWRFRHIYRG QPRRHLLTTG WSAFVNKKKL VSGDAVLFLR 60 GEDGVLRLGV RRAAQLKNVS PVPALFNQDS SLSSLGNVAQ AVAVKSIFHI YYNPRLCESE 120 FIVPYWKFMR SFSQPSSVGM RFKMKYENED ASERRSTGTI TGSRESDPKS HGSKWKCL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ldy_A | 2e-55 | 2 | 178 | 154 | 331 | Auxin response factor 1 |
4ldy_B | 2e-55 | 2 | 178 | 154 | 331 | Auxin response factor 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY376129 | 0.0 | AY376129.1 Triticum aestivum ETTIN-like auxin response factor (ETT2-alpha) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020160561.1 | 1e-123 | auxin response factor 2-like isoform X1 | ||||
Refseq | XP_020160562.1 | 1e-123 | auxin response factor 2-like isoform X2 | ||||
Swissprot | Q0JKI9 | 1e-104 | ARFB_ORYSJ; Auxin response factor 2 | ||||
TrEMBL | A0A453F7I0 | 1e-126 | A0A453F7I0_AEGTS; Auxin response factor | ||||
STRING | Traes_3DL_5C378695E.1 | 1e-131 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2537 | 35 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33860.1 | 3e-73 | ARF family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|