PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DL_46F83C41D.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 106aa MW: 12380.1 Da PI: 9.9609 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 29.7 | 1.5e-09 | 4 | 36 | 16 | 48 |
HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + ++G g+W++++r g+ R++k+c++rw +yl Traes_3DL_46F83C41D.1 4 IIRYGVGCWSSVPRLAGLERCGKSCRLRWINYL 36 6689***************************97 PP | |||||||
2 | Myb_DNA-binding | 53 | 8.1e-17 | 42 | 85 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+++++E++l+v ++k lG++ W+ Ia+ ++ gRt++++k++w++ Traes_3DL_46F83C41D.1 42 RGSFSQQEEDLIVSLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 85 89********************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 17 | 1 | 38 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 10.009 | 1 | 36 | IPR017930 | Myb domain |
CDD | cd00167 | 2.49E-4 | 1 | 36 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-15 | 4 | 43 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.4E-7 | 5 | 36 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.02E-22 | 22 | 97 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.908 | 37 | 91 | IPR017930 | Myb domain |
SMART | SM00717 | 6.5E-15 | 41 | 89 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.4E-15 | 42 | 85 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.3E-26 | 44 | 91 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.22E-10 | 44 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
YNHIIRYGVG CWSSVPRLAG LERCGKSCRL RWINYLRPDL KRGSFSQQEE DLIVSLHKIL 60 GNRWSQIASQ LPGRTDNEIK NFWNSCIKKK LRQQSIDPTT HEPLND |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 8e-26 | 4 | 91 | 22 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP092593 | 1e-120 | FP092593.1 Phyllostachys edulis cDNA clone: bphylf046j05, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020192081.1 | 3e-73 | myb-related protein Hv33-like | ||||
Swissprot | P20027 | 2e-64 | MYB3_HORVU; Myb-related protein Hv33 | ||||
TrEMBL | A0A453EVH7 | 4e-74 | A0A453EVH7_AEGTS; Uncharacterized protein | ||||
STRING | EMT07074 | 7e-73 | (Aegilops tauschii) | ||||
STRING | Traes_3DL_46F83C41D.1 | 9e-74 | (Triticum aestivum) | ||||
STRING | TRIUR3_27020-P1 | 1e-72 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP11164 | 30 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26660.1 | 5e-61 | myb domain protein 86 |
Publications ? help Back to Top | |||
---|---|---|---|
|