PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3B_174B7D5D2.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 118aa MW: 12524.4 Da PI: 9.6566 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 37.6 | 4.1e-12 | 1 | 33 | 55 | 87 |
ETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS B3 55 ksgryvltkGWkeFvkangLkegDfvvFkldgr 87 +s++yvltkGW++Fvk++gL +gD+v F+++ Traes_3B_174B7D5D2.1 1 SSQSYVLTKGWSRFVKEKGLGAGDVVGFYRSAA 33 5899*************************7644 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 9.545 | 1 | 50 | IPR003340 | B3 DNA binding domain |
Pfam | PF02362 | 2.9E-9 | 1 | 33 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 8.0E-13 | 1 | 59 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 1.65E-9 | 1 | 36 | No hit | No description |
SuperFamily | SSF101936 | 1.49E-9 | 2 | 34 | IPR015300 | DNA-binding pseudobarrel domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
SSQSYVLTKG WSRFVKEKGL GAGDVVGFYR SAAGSTGEDT KLFIDCKLRP DTNSPASADP 60 VDQSAPVQKA VRLFGVDLLT APASPEQGMP GCKRARDLVK SPPPKVAFKK QCIELALA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5os9_A | 8e-15 | 1 | 50 | 66 | 114 | B3 domain-containing transcription factor NGA1 |
5os9_B | 8e-15 | 1 | 50 | 66 | 114 | B3 domain-containing transcription factor NGA1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK369681 | 1e-112 | AK369681.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2095J19. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020185929.1 | 4e-65 | AP2/ERF and B3 domain-containing protein Os01g0693400-like | ||||
Swissprot | Q8RZX9 | 4e-42 | Y1934_ORYSJ; AP2/ERF and B3 domain-containing protein Os01g0693400 | ||||
TrEMBL | A0A446PWD7 | 6e-78 | A0A446PWD7_TRITD; Uncharacterized protein | ||||
STRING | Traes_3B_174B7D5D2.1 | 1e-80 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP456 | 38 | 203 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68840.2 | 4e-20 | related to ABI3/VP1 2 |