PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3AS_6626D4A69.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 149aa MW: 16262.1 Da PI: 9.8529 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48 | 2.9e-15 | 4 | 48 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky Traes_3AS_6626D4A69.1 4 PWTEDEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 48 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.046 | 1 | 53 | IPR017930 | Myb domain |
SMART | SM00717 | 1.4E-12 | 1 | 51 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.2E-12 | 1 | 47 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 9.72E-17 | 2 | 53 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.3E-17 | 2 | 51 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.0E-12 | 4 | 48 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.78E-12 | 4 | 49 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
KGVPWTEDEH KLFLLGLKKY GKGDWRNISR NFVQTRTPTQ VASHAQKYFI RLSSGGGKDK 60 RRSSIHDITT VHLDDQPPSP SQSSMITQSS APAPSPATGQ YSLPADTKQH GGANAPYNSP 120 PSYGMGLQDQ GLQCGPLHDQ LAANRSMLY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 0.0 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020200804.1 | 1e-103 | transcription factor DIVARICATA-like | ||||
Refseq | XP_020200805.1 | 1e-103 | transcription factor DIVARICATA-like | ||||
Swissprot | Q8S9H7 | 2e-43 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A446N2Z2 | 1e-104 | A0A446N2Z2_TRITD; Uncharacterized protein | ||||
STRING | Traes_3AS_6626D4A69.1 | 1e-107 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7886 | 33 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 2e-22 | Homeodomain-like transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|