PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3AS_5E49D47AF.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 129aa MW: 14676.8 Da PI: 10.1852 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.9 | 9.5e-18 | 32 | 79 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd ll +++ +G g+W++ ar+ g++Rt+k+c++rw++yl Traes_3AS_5E49D47AF.1 32 RGPWTLEEDNLLMSYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYL 79 89*********************************************7 PP | |||||||
2 | Myb_DNA-binding | 52.8 | 8.9e-17 | 85 | 128 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++ ++++++++G++ W++Ia++++ gRt++++k++w++ Traes_3AS_5E49D47AF.1 85 RGNLTAEEQLVILELHAKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 128 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.79 | 27 | 79 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.56E-31 | 30 | 126 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-13 | 31 | 81 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-15 | 32 | 79 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.6E-24 | 33 | 86 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.17E-9 | 34 | 79 | No hit | No description |
PROSITE profile | PS51294 | 25.028 | 80 | 129 | IPR017930 | Myb domain |
SMART | SM00717 | 5.0E-10 | 84 | 129 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.9E-15 | 85 | 128 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.1E-23 | 87 | 129 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.91E-10 | 89 | 128 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MSRRKGAAAA GGGGAGPMEM AAMEEEAAEL RRGPWTLEED NLLMSYIACH GEGRWNLLAR 60 CSGLKRTGKS CRLRWLNYLK PDIKRGNLTA EEQLVILELH AKWGNRWSRI AQHLPGRTDN 120 EIKNYWRTR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-26 | 29 | 128 | 1 | 99 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 2e-26 | 29 | 128 | 24 | 122 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269|PubMed:11310740}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269|PubMed:11310740}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 1e-105 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025814736.1 | 2e-70 | transcription factor MYB2-like | ||||
Swissprot | Q2QZJ8 | 9e-61 | JAMYB_ORYSJ; Transcription factor JAMYB | ||||
TrEMBL | A0A3B6EAR0 | 2e-87 | A0A3B6EAR0_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446N1Y2 | 3e-88 | A0A446N1Y2_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A446N208 | 2e-87 | A0A446N208_TRITD; Uncharacterized protein | ||||
TrEMBL | M7Y993 | 2e-87 | M7Y993_TRIUA; Transcription factor MYB21 | ||||
STRING | Traes_3AS_5E49D47AF.1 | 4e-89 | (Triticum aestivum) | ||||
STRING | TRIUR3_09345-P1 | 3e-88 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP198 | 38 | 330 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68320.1 | 3e-59 | myb domain protein 62 |