PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3AL_D098A5241.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 88aa MW: 9705.18 Da PI: 11.0663 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28.7 | 3e-09 | 57 | 88 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg W++eEde+l++ + ++G g+W++++r g Traes_3AL_D098A5241.2 57 RGLWSPEEDEKLYNHIIRYGVGCWSSVPRLAG 88 789*************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.6E-11 | 50 | 86 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.359 | 52 | 88 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.45E-8 | 52 | 86 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 9.0E-7 | 57 | 87 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.42E-6 | 60 | 88 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
SLSLSLSLAQ RSGPFLFLSR YRARSLVTPP GSTHMRAMGR EAATAVACSS NKPKLRRGLW 60 SPEEDEKLYN HIIRYGVGCW SSVPRLAG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 2e-96 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020192081.1 | 2e-30 | myb-related protein Hv33-like | ||||
Swissprot | P20027 | 2e-18 | MYB3_HORVU; Myb-related protein Hv33 | ||||
TrEMBL | A0A453EVH7 | 9e-47 | A0A453EVH7_AEGTS; Uncharacterized protein | ||||
STRING | Traes_3AL_D098A5241.2 | 6e-58 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP11164 | 30 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26660.1 | 2e-16 | myb domain protein 86 |
Publications ? help Back to Top | |||
---|---|---|---|
|