PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3AL_A8AF980F3.1 | ||||||||
Common Name | MYB13-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 152aa MW: 17360.8 Da PI: 11.238 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.1 | 5.5e-15 | 29 | 76 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed +l+ v+++G ++W+ a+ g++Rt+k+c++rw +yl Traes_3AL_A8AF980F3.1 29 KGPWTEQEDMKLAWFVRLFGERRWDFLAKVSGLNRTGKSCRLRWVNYL 76 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 58.9 | 1.1e-18 | 82 | 126 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rgr+++eE+ l vd+++++G++ W++Ia+ m+ gRt++++k++w+++ Traes_3AL_A8AF980F3.1 82 RGRMSPEEERLVVDLHARWGNR-WSRIAKAMP-GRTDNEIKNYWRTH 126 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.417 | 24 | 76 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.53E-29 | 27 | 123 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-12 | 28 | 78 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.4E-14 | 29 | 76 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.1E-20 | 30 | 82 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.25E-8 | 31 | 76 | No hit | No description |
PROSITE profile | PS51294 | 25.027 | 77 | 131 | IPR017930 | Myb domain |
SMART | SM00717 | 3.6E-16 | 81 | 129 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-16 | 82 | 126 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.8E-24 | 83 | 129 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.98E-11 | 84 | 126 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MKTKQASKAK AAPSPGKEEE AVASGGFRKG PWTEQEDMKL AWFVRLFGER RWDFLAKVSG 60 LNRTGKSCRL RWVNYLHPDL KRGRMSPEEE RLVVDLHARW GNRWSRIAKA MPGRTDNEIK 120 NYWRTHTRKL HKDTRASAAS ASTTTSTSMS AA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 4e-28 | 29 | 129 | 4 | 103 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 1e-27 | 20 | 129 | 49 | 157 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 1e-27 | 20 | 129 | 49 | 157 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 4e-28 | 29 | 129 | 4 | 103 | C-Myb DNA-Binding Domain |
1msf_C | 4e-28 | 29 | 129 | 4 | 103 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF288934 | 0.0 | JF288934.1 Triticum aestivum MYB13-1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020185558.1 | 3e-89 | transcription factor MYB59-like | ||||
Swissprot | Q4JL76 | 2e-62 | MYBA2_ORYSJ; Myb-related protein MYBAS2 | ||||
TrEMBL | S4V9N0 | 1e-107 | S4V9N0_WHEAT; MYB13 transcription factor | ||||
STRING | Traes_3AL_A8AF980F3.1 | 1e-108 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP636 | 37 | 169 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59780.3 | 2e-61 | myb domain protein 59 |
Publications ? help Back to Top | |||
---|---|---|---|
|