PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3AL_490F09661.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 163aa MW: 19201.9 Da PI: 10.0812 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 162.4 | 1.7e-50 | 2 | 126 | 3 | 128 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ Traes_3AL_490F09661.2 2 PGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADR 88 9***************************.89***************8778899*********************************** PP NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + +++++ +glkktLvfy+g+apkg++++W+m+eyrl Traes_3AL_490F09661.2 89 MIRAENNRSIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 126 ************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 51.267 | 1 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.6E-26 | 2 | 126 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.31E-53 | 2 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MPGFRFHPTE EELIEFYLRR KVEGKRFNVE LITFLDLYRY DPWELPALAA IGEKEWFFYV 60 PRDRKYRNGD RPNRVTASGY WKATGADRMI RAENNRSIGL KKTLVFYSGK APKGVRSSWI 120 MNEYRLPTAD TDRYHKVYPS YIIASPRNSP PDLSICARNG RPE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-53 | 2 | 126 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-53 | 2 | 126 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-53 | 2 | 126 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-53 | 2 | 126 | 19 | 142 | NO APICAL MERISTEM PROTEIN |
4dul_A | 3e-53 | 2 | 126 | 19 | 142 | NAC domain-containing protein 19 |
4dul_B | 3e-53 | 2 | 126 | 19 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FR819762 | 0.0 | FR819762.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC012 gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020179754.1 | 1e-96 | protein BEARSKIN2-like | ||||
Swissprot | Q9ZVP8 | 3e-87 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A453G6H1 | 1e-110 | A0A453G6H1_AEGTS; Uncharacterized protein | ||||
STRING | Traes_3AL_490F09661.2 | 1e-117 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2826 | 37 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.2 | 1e-89 | NAC domain containing protein 35 |
Publications ? help Back to Top | |||
---|---|---|---|
|