PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DS_E764EF72B.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family BES1
Protein Properties Length: 90aa    MW: 10072.4 Da    PI: 10.7229
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DS_E764EF72B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822155.24.8e-481787272
                 DUF822  2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkg 72
                           g gr+ptwkErEnnkrRERrRRaiaaki++GLRa Gnyklpk++DnneVlk LcreAGwvvedDGttyrk 
  Traes_2DS_E764EF72B.1 17 GLGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKELCREAGWVVEDDGTTYRKV 87
                           679******************************************************************85 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.1E-441887IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MTSGAARAAA AAEADAGLGR TPTWKERENN KRRERRRRAI AAKIFTGLRA LGNYKLPKHC  60
DNNEVLKELC REAGWVVEDD GTTYRKVRAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A4e-242086372438Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B4e-242086372438Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C4e-242086372438Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D4e-242086372438Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPositive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid biosynthetic genes. May act as transcriptional repressor by binding the brassinosteroid-response element (5'-CGTGCG-3') in the promoter of GRAS32 (AC Q9LWU9), another positive regulator of brassinosteroid signaling (By similarity). {ECO:0000250}.
UniProtPositive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid (BR) biosynthetic genes (PubMed:17699623, PubMed:19220793). May act as transcriptional repressor by binding the brassinosteroid-response element (BREE) (5'-CGTG(T/C)G-3') in the promoter of DLT (AC Q9LWU9), another positive regulator of BR signaling (PubMed:19220793). Acts as transcriptional repressor of LIC, a negative regulator of BR signaling, by binding to the BRRE element of its promoter. BZR1 and LIC play opposite roles in BR signaling and regulation of leaf bending (PubMed:22570626). {ECO:0000269|PubMed:17699623, ECO:0000269|PubMed:19220793, ECO:0000269|PubMed:22570626}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269|PubMed:22570626}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN4007391e-131JN400739.1 Triticum aestivum cultivar Chinese Spring BES1 mRNA, complete cds.
GenBankJN4007401e-131JN400740.1 Triticum aestivum cultivar Chinese Spring BES1S mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020151437.13e-56protein BZR1 homolog 1
SwissprotB8B7S57e-28BZR1_ORYSI; Protein BZR1 homolog 1
SwissprotQ7XI967e-28BZR1_ORYSJ; Protein BZR1 homolog 1
TrEMBLA0A3B6DDH57e-55A0A3B6DDH5_WHEAT; Uncharacterized protein
TrEMBLH9U3X58e-56H9U3X5_WHEAT; BES1S
STRINGTraes_2DS_E764EF72B.18e-59(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54743453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36780.19e-25BES1/BZR1 homolog 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Tong H, et al.
    DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice.
    Plant Cell, 2012. 24(6): p. 2562-77
    [PMID:22685166]
  3. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]