PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2DS_9A08AAEE4.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 119aa MW: 12498.4 Da PI: 7.5107 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 41.7 | 1.9e-13 | 66 | 119 | 2 | 55 |
GRAS 2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55 ++lL++cA+a++++d++l+q++L+ l+++a dgd++qRl+a f+ AL ar +r Traes_2DS_9A08AAEE4.1 66 EQLLVHCANAIEANDATLTQQILWVLNNIAPADGDSNQRLTAAFLCALVARASR 119 79***********************************************99765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 10.625 | 39 | 119 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 6.5E-11 | 66 | 119 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MMQFTHAAVT APPLYPNGHH GLGLGLFLDV GAPRARPWPA AGSLFPTLPP SSKISLGNLN 60 SAGCMEQLLV HCANAIEAND ATLTQQILWV LNNIAPADGD SNQRLTAAFL CALVARASR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK362740 | 1e-169 | AK362740.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2009M24. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020165039.1 | 1e-79 | scarecrow-like protein 32 | ||||
Swissprot | Q9SN22 | 2e-22 | SCL32_ARATH; Scarecrow-like protein 32 | ||||
TrEMBL | A0A1D5UV25 | 2e-78 | A0A1D5UV25_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A3B6AUR2 | 2e-78 | A0A3B6AUR2_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446KTE6 | 2e-78 | A0A446KTE6_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A453B6G1 | 2e-78 | A0A453B6G1_AEGTS; Uncharacterized protein | ||||
STRING | Traes_2BS_FDABA21A7.1 | 5e-78 | (Triticum aestivum) | ||||
STRING | Traes_2DS_9A08AAEE4.1 | 1e-81 | (Triticum aestivum) | ||||
STRING | TRIUR3_31604-P1 | 9e-79 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5697 | 37 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49950.1 | 1e-24 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|