PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_304E62CCE.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 81aa    MW: 9398.68 Da    PI: 10.456
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_304E62CCE.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.2e-172670248
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           g ++ eE+e    +++ lG++ W+ Ia++++ gRt++++k++w++yl
  Traes_2DL_304E62CCE.1 26 GMFSREEEETVMSLHATLGNK-WSQIAQHLP-GRTDNEVKNYWNSYL 70
                           5699*****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.379119IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-9531IPR009057Homeodomain-like
SuperFamilySSF466898.53E-24575IPR009057Homeodomain-like
PROSITE profilePS5129424.2542074IPR017930Myb domain
SMARTSM007172.6E-132472IPR001005SANT/Myb domain
PfamPF002495.9E-162670IPR001005SANT/Myb domain
CDDcd001671.67E-102870No hitNo description
Gene3DG3DSA:1.10.10.601.7E-223271IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
ISGLERNGKS CRLRWINYLR PGLKHGMFSR EEEETVMSLH ATLGNKWSQI AQHLPGRTDN  60
EVKNYWNSYL KKRVEGARSP A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-2167540109B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3705131e-108AK370513.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2111O05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020156817.13e-52transcription factor LAF1-like
SwissprotQ9M0K47e-36LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A1D5UNR26e-51A0A1D5UNR2_WHEAT; Uncharacterized protein
TrEMBLA0A453CFH36e-51A0A453CFH3_AEGTS; Uncharacterized protein
TrEMBLM8AYF03e-51M8AYF0_AEGTA; Uncharacterized protein
STRINGTraes_2DL_304E62CCE.12e-54(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.13e-38myb domain protein 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]