PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2DL_02C9FBBB4.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 94aa MW: 10310.8 Da PI: 10.7854 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 53.7 | 4.4e-17 | 44 | 94 | 2 | 52 |
Whirly 2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekk 52 v+k+kaal++ +++p f++l+sg +++r+G+++l++ +a+++rkyd+ kk Traes_2DL_02C9FBBB4.1 44 VFKGKAALSISPILPLFTKLESGGSRVNRNGSVMLTFFPAVGQRKYDYTKK 94 9***********************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 3.7E-23 | 31 | 94 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 4.47E-20 | 36 | 94 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 2.7E-17 | 44 | 94 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
LFRGVTDLKD VLWSSSLTFK HALSTSAANV DESTSARKFA SYTVFKGKAA LSISPILPLF 60 TKLESGGSRV NRNGSVMLTF FPAVGQRKYD YTKK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4kop_A | 3e-22 | 35 | 94 | 8 | 67 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_B | 3e-22 | 35 | 94 | 8 | 67 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_C | 3e-22 | 35 | 94 | 8 | 67 | Single-stranded DNA-binding protein WHY2, mitochondrial |
4kop_D | 3e-22 | 35 | 94 | 8 | 67 | Single-stranded DNA-binding protein WHY2, mitochondrial |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo. {ECO:0000269|PubMed:18423020, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:22762281}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK249976 | 1e-112 | AK249976.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf60h16, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020180430.1 | 1e-54 | single-stranded DNA-bindig protein WHY2, mitochondrial | ||||
Swissprot | Q8VYF7 | 1e-21 | WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A3B6PHE2 | 3e-58 | A0A3B6PHE2_WHEAT; Uncharacterized protein | ||||
STRING | Traes_2DL_02C9FBBB4.1 | 6e-62 | (Triticum aestivum) | ||||
STRING | Traes_6BS_0A692E6F6.1 | 2e-60 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3012 | 38 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 5e-24 | WHIRLY 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|