PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_24E6E8DF9.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 339aa    MW: 38643.5 Da    PI: 6.989
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_24E6E8DF9.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.3e-5471361129
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWka 85 
                            +ppGfrFhPtdeelv++yL+kkv+ k+++l ++ik+vd+yk+ePwdL++  k+ + ++++w+fFs++dkky+tg+r+nrat++g+Wka
  Traes_2BL_24E6E8DF9.1   7 VPPGFRFHPTDEELVDYYLRKKVQLKRIDL-DIIKDVDLYKIEPWDLQErcKIGTeDQNDWFFFSHKDKKYPTGTRTNRATTAGFWKA 93 
                            69****************************.99**************953444442455***************************** PP

                    NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                            tg+dk++++ k+ lvg++ktLvfykgrap+g+k dW+mheyrle
  Traes_2BL_24E6E8DF9.1  94 TGRDKPIYV-KHCLVGMRKTLVFYKGRAPNGQKLDWIMHEYRLE 136
                            *********.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-595156IPR003441NAC domain
PROSITE profilePS5100557.5867156IPR003441NAC domain
PfamPF023659.9E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MNVFSHVPPG FRFHPTDEEL VDYYLRKKVQ LKRIDLDIIK DVDLYKIEPW DLQERCKIGT  60
EDQNDWFFFS HKDKKYPTGT RTNRATTAGF WKATGRDKPI YVKHCLVGMR KTLVFYKGRA  120
PNGQKLDWIM HEYRLETNEN GAPHDEGWVV CKVFKKRVAT VQRMATVDSP FWFNHDHAAF  180
MAPHVDSPRQ AVHHLQNAAY HHGHHQTYHH PCKVELEYHQ LLPQEPASFL QLPQLEMPGL  240
PGLIGAVAAS LQPCNQTHDG QASRQLEIEP VYVTDASAGE WRDLDKFMAS QLSHDGSTPK  300
ESSGYANPAV AFQAEGKHEE ALDYVSASAS SGGDNGLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-48615714169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934230.0JQ693423.1 Brachypodium distachyon SWN2 (SWN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167162.10.0NAC domain-containing protein 7-like
RefseqXP_020167163.10.0NAC domain-containing protein 7-like
RefseqXP_020167164.10.0NAC domain-containing protein 7-like
RefseqXP_020167165.10.0NAC domain-containing protein 7-like
RefseqXP_020167167.10.0NAC domain-containing protein 7-like
SwissprotQ9FWX21e-118NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A3B6CAC80.0A0A3B6CAC8_WHEAT; Uncharacterized protein
TrEMBLA0A446MJG30.0A0A446MJG3_TRITD; Uncharacterized protein
STRINGTraes_2BL_24E6E8DF9.10.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-110NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]