PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2AS_960C7E44E.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 41aa MW: 4629.22 Da PI: 5.5219 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 21.1 | 3.4e-07 | 3 | 38 | 337 | 373 |
GRAS 337 aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 ++++l++++ g+ ++ e++ l+l+Wk++++v++SaW Traes_2AS_960C7E44E.1 3 IRTMLNEHA-AGWGMKREDDDLMLTWKGHNVVFASAW 38 678899998.889999********************* PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 41 aa Download sequence Send to blast |
GEIRTMLNEH AAGWGMKRED DDLMLTWKGH NVVFASAWAP S |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK362740 | 2e-54 | AK362740.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2009M24. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020165039.1 | 1e-21 | scarecrow-like protein 32 | ||||
Swissprot | Q9SN22 | 5e-14 | SCL32_ARATH; Scarecrow-like protein 32 | ||||
TrEMBL | A0A3B6C330 | 2e-20 | A0A3B6C330_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446KTH2 | 1e-20 | A0A446KTH2_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A446M2X2 | 2e-20 | A0A446M2X2_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A446M334 | 1e-20 | A0A446M334_TRITD; Uncharacterized protein | ||||
TrEMBL | M8AQZ0 | 1e-20 | M8AQZ0_TRIUA; Uncharacterized protein | ||||
STRING | Traes_2DS_FB1D2D1A7.1 | 5e-23 | (Triticum aestivum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49950.1 | 2e-16 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|