PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_2AS_5D0C0E5BB.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

BES1

Protein Properties

Length: 90aa MW: 10086.4 Da PI: 10.7229

Description

BES1 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2AS_5D0C0E5BB.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF822	155.7	3.3e-48	17	88	2	73
DUF822 2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgs 73 g gr+ptwkErEnnkrRERrRRaiaaki++GLRa Gnyklpk++DnneVlk LcreAGwvvedDGttyrk s Traes_2AS_5D0C0E5BB.1 17 GLGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKELCREAGWVVEDDGTTYRKVS 88 679******************************************************************965 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF05687	6.5E-44	18	88	IPR008540	BES1/BZR1 plant transcription factor, N-terminal

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MTSGAARAAA AAEAEAGLGR TPTWKERENN KRRERRRRAI AAKIFTGLRA LGNYKLPKHC 60 DNNEVLKELC REAGWVVEDD GTTYRKVSAR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5zd4_A	4e-24	20	86	372	438	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B	4e-24	20	86	372	438	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C	4e-24	20	86	372	438	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D	4e-24	20	86	372	438	Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Positive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid biosynthetic genes. May act as transcriptional repressor by binding the brassinosteroid-response element (5'-CGTGCG-3') in the promoter of GRAS32 (AC Q9LWU9), another positive regulator of brassinosteroid signaling (By similarity). {ECO:0000250}.
UniProt	Positive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid (BR) biosynthetic genes (PubMed:17699623, PubMed:19220793). May act as transcriptional repressor by binding the brassinosteroid-response element (BREE) (5'-CGTG(T/C)G-3') in the promoter of DLT (AC Q9LWU9), another positive regulator of BR signaling (PubMed:19220793). Acts as transcriptional repressor of LIC, a negative regulator of BR signaling, by binding to the BRRE element of its promoter. BZR1 and LIC play opposite roles in BR signaling and regulation of leaf bending (PubMed:22570626). {ECO:0000269\|PubMed:17699623, ECO:0000269\|PubMed:19220793, ECO:0000269\|PubMed:22570626}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269\|PubMed:22570626}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JN400739	1e-143	JN400739.1 Triticum aestivum cultivar Chinese Spring BES1 mRNA, complete cds.
GenBank	JN400740	1e-143	JN400740.1 Triticum aestivum cultivar Chinese Spring BES1S mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020151437.1	2e-55	protein BZR1 homolog 1
Swissprot	B8B7S5	6e-28	BZR1_ORYSI; Protein BZR1 homolog 1
Swissprot	Q7XI96	6e-28	BZR1_ORYSJ; Protein BZR1 homolog 1
TrEMBL	A0A446KT22	8e-58	A0A446KT22_TRITD; Uncharacterized protein
STRING	Traes_2AS_5D0C0E5BB.1	1e-58	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5474	34	53

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G36780.1	9e-25	BES1/BZR1 homolog 2

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Tong H, et al. DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice. Plant Cell, 2012. 24(6): p. 2562-77 [PMID:22685166] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]