PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2AL_F0B17F0EA.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 194aa MW: 22931.8 Da PI: 10.4192 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 169.8 | 8.7e-53 | 10 | 139 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWka 85 +ppGfrFhPtdeel+ +yLkkk+ +k++l evi+evd++k+ePwdL++ ++ + ++ewyfFs++d+ky+tg+r+nrat++g+Wka Traes_2AL_F0B17F0EA.1 10 VPPGFRFHPTDEELLLYYLKKKIGFEKFDL-EVIREVDLNKIEPWDLQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRATTAGFWKA 96 69****************************.99**************963433332566***************************** PP NAM 86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 tg+dk + + + +++g++ktLvfy+grap+g+k+dW+mheyrle Traes_2AL_F0B17F0EA.1 97 TGRDKCIRT-SYRKIGMRKTLVFYRGRAPHGQKSDWIMHEYRLE 139 ********9.8999****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.75E-59 | 6 | 161 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.388 | 10 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.3E-28 | 11 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MADFSSSNGV PPGFRFHPTD EELLLYYLKK KIGFEKFDLE VIREVDLNKI EPWDLQERCR 60 IGSAPQNEWY FFSHKDRKYP TGSRTNRATT AGFWKATGRD KCIRTSYRKI GMRKTLVFYR 120 GRAPHGQKSD WIMHEYRLEE IDEAQGGTSE DGWVVCRVFK KXXXXXRRGE LEPERGRRRR 180 PHGRVLAAGW PRPR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-55 | 10 | 161 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-55 | 10 | 161 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-55 | 10 | 161 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-55 | 10 | 161 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-55 | 10 | 161 | 20 | 168 | NAC domain-containing protein 19 |
3swm_B | 4e-55 | 10 | 161 | 20 | 168 | NAC domain-containing protein 19 |
3swm_C | 4e-55 | 10 | 161 | 20 | 168 | NAC domain-containing protein 19 |
3swm_D | 4e-55 | 10 | 161 | 20 | 168 | NAC domain-containing protein 19 |
3swp_A | 4e-55 | 10 | 161 | 20 | 168 | NAC domain-containing protein 19 |
3swp_B | 4e-55 | 10 | 161 | 20 | 168 | NAC domain-containing protein 19 |
3swp_C | 4e-55 | 10 | 161 | 20 | 168 | NAC domain-containing protein 19 |
3swp_D | 4e-55 | 10 | 161 | 20 | 168 | NAC domain-containing protein 19 |
4dul_A | 3e-55 | 10 | 161 | 17 | 165 | NAC domain-containing protein 19 |
4dul_B | 3e-55 | 10 | 161 | 17 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU971542 | 0.0 | EU971542.1 Zea mays clone 366845 NAC domain-containing protein 76 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003579837.1 | 1e-118 | protein BEARSKIN1 | ||||
Swissprot | Q9SV87 | 1e-100 | BRN2_ARATH; Protein BEARSKIN2 | ||||
TrEMBL | I1IY55 | 1e-117 | I1IY55_BRADI; Uncharacterized protein | ||||
STRING | Traes_2AL_F0B17F0EA.1 | 1e-137 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP9297 | 30 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G10350.1 | 5e-95 | NAC domain containing protein 70 |
Publications ? help Back to Top | |||
---|---|---|---|
|