PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2AL_C13CD3ECB.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 195aa MW: 20423.1 Da PI: 10.9892 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 40.8 | 5.2e-13 | 30 | 74 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E+ l++ + +++G+g+W++I+r + Rt+ q+ s+ qky Traes_2AL_C13CD3ECB.1 30 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 74 6*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.605 | 23 | 79 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.97E-17 | 25 | 80 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.3E-11 | 27 | 77 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 1.3E-17 | 27 | 77 | IPR006447 | Myb domain, plants |
CDD | cd00167 | 6.39E-11 | 30 | 75 | No hit | No description |
Pfam | PF00249 | 1.7E-11 | 30 | 74 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.8E-11 | 30 | 73 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
GGKKSGGGGG GHGEKGSSKS AEQERRKGIA WTEDEHRLFL LGLEKYGKGD WRSISRNFVI 60 SRTPTQVASH AQKYFIRLNS MNRERRRSSI HDITSVNGEA SAAQGPITGT NGQAAVPGKS 120 PKQSPHQPGN LPPGVDAFGT TIGQPVGGPL VSAVGTPVTL PVAAPPHMGY AMHAPVPGTV 180 VPRAPMYPMP PPPSR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK366932 | 0.0 | AK366932.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2048J09. | |||
GenBank | AK372619 | 0.0 | AK372619.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3007D08. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020192024.1 | 1e-139 | transcription factor SRM1-like | ||||
Swissprot | Q9FNN6 | 3e-67 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A1D5UKM6 | 1e-138 | A0A1D5UKM6_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A3B6CIP8 | 1e-138 | A0A3B6CIP8_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446MX40 | 1e-138 | A0A446MX40_TRITD; Uncharacterized protein | ||||
STRING | Traes_2AL_C13CD3ECB.1 | 1e-138 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6376 | 38 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08520.1 | 1e-66 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|