PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2AL_2FE59A2DC.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 155aa MW: 16903.3 Da PI: 10.8048 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 77.9 | 1e-24 | 62 | 106 | 1 | 45 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 ++ep rCrRtDGKkWRCsr v++g+k+CErH+hrgrsr rk++e+ Traes_2AL_2FE59A2DC.1 62 EPEPDRCRRTDGKKWRCSRGVVPGHKYCERHVHRGRSRARKPVEA 106 699***************************************985 PP | |||||||
2 | QLQ | 50 | 9e-18 | 1 | 32 | 6 | 37 |
QLQ 6 aQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 +Q q+L++Q+l+y+y+aan+PvP +L+++i+k Traes_2AL_2FE59A2DC.1 1 MQRQELEHQVLIYRYFAANAPVPVHLVLPIWK 32 69*****************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51666 | 20.68 | 1 | 32 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 8.1E-11 | 2 | 31 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 24.673 | 62 | 106 | IPR014977 | WRC domain |
Pfam | PF08879 | 7.6E-21 | 63 | 105 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MQRQELEHQV LIYRYFAANA PVPVHLVLPI WKSVAASSSA PQRFPSLAGL GSMCYDHRSS 60 MEPEPDRCRR TDGKKWRCSR GVVPGHKYCE RHVHRGRSRA RKPVEAAAAT SAVPIRAMHA 120 ADAQGATSAH AAPPQRLGFS SPAGVYLAHG TARAT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU976393 | 1e-101 | EU976393.1 Zea mays clone 881905 growth-regulating factor mRNA, complete cds. | |||
GenBank | KJ727857 | 1e-101 | KJ727857.1 Zea mays clone pUT5948 GRF transcription factor (GRF9) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020188115.1 | 1e-109 | growth-regulating factor 12-like | ||||
Refseq | XP_020197443.1 | 1e-109 | growth-regulating factor 12-like | ||||
Swissprot | Q6AWX7 | 4e-70 | GRF12_ORYSJ; Growth-regulating factor 12 | ||||
TrEMBL | A0A3B6B441 | 1e-109 | A0A3B6B441_WHEAT; Uncharacterized protein | ||||
STRING | Traes_2AL_2FE59A2DC.1 | 1e-110 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6221 | 30 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G52910.1 | 2e-34 | growth-regulating factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|