PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_1DS_F22A3DB6A.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MIKC_MADS

Protein Properties

Length: 269aa MW: 30418.3 Da PI: 9.6273

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_1DS_F22A3DB6A.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	97.4	5.9e-31	45	95	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs +g+lyeys+ Traes_1DS_F22A3DB6A.1 45 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSGRGRLYEYSN 95 79***********************************************95 PP
2	K-box	103.8	2.3e-34	112	209	3	100
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 +ss ++e +a+++qqe+akLk++i +Lq+++R l+G+ + ++s+++L+qLe +L+k+l kiR++Knell+++ie++q++e elq++ Traes_1DS_F22A3DB6A.1 112 TSSAGTVAEINAQHYQQESAKLKQQITTLQNSNRTLIGDTMATMSHRDLKQLEGRLDKGLGKIRARKNELLCAEIEYMQRREMELQNN 199 4455559999**************************************************************************** PP K-box 91 nkaLrkklee 100 n Lr+k++e Traes_1DS_F22A3DB6A.1 200 NFFLREKVAE 209 *****986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	7.1E-41	37	96	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.543	37	97	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.55E-44	38	114	No hit	No description
SuperFamily	SSF55455	2.22E-32	38	109	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	39	93	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-32	39	59	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.3E-26	46	93	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-32	59	74	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-32	74	95	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.7E-25	122	207	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	13.598	123	213	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 269 aa Download sequence Send to blast
MQILNEQLAA PSTGLMVKES ASPGSGSGSA GGAAEKMGRG RIEIKRIENT TNRQVTFCKR 60 RNGLLKKAYE LSVLCDAEVA LIVFSGRGRL YEYSNNSVKA TIERYKKATS DTSSAGTVAE 120 INAQHYQQES AKLKQQITTL QNSNRTLIGD TMATMSHRDL KQLEGRLDKG LGKIRARKNE 180 LLCAEIEYMQ RREMELQNNN FFLREKVAET ERGQQQTLNM MGAASTSNEY EQNMIHCDPR 240 TFLQFNFMQQ QPQYYSQQED RKSFNSVGR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-19	37	105	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-19	37	105	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	1e-19	37	105	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	1e-19	37	105	1	69	Myocyte-specific enhancer factor 2B
5f28_A	2e-19	37	105	1	69	MEF2C
5f28_B	2e-19	37	105	1	69	MEF2C
5f28_C	2e-19	37	105	1	69	MEF2C
5f28_D	2e-19	37	105	1	69	MEF2C
6byy_A	2e-19	37	105	1	69	MEF2 CHIMERA
6byy_B	2e-19	37	105	1	69	MEF2 CHIMERA
6byy_C	2e-19	37	105	1	69	MEF2 CHIMERA
6byy_D	2e-19	37	105	1	69	MEF2 CHIMERA
6c9l_A	1e-19	37	105	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	1e-19	37	105	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	1e-19	37	105	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	1e-19	37	105	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	1e-19	37	105	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	1e-19	37	105	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269\|PubMed:16326928}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT008912	0.0	BT008912.1 Triticum aestivum clone wpa1c.pk001.p9:fis, full insert mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020176048.1	0.0	MADS-box transcription factor 58-like isoform X2
Swissprot	Q2V0P1	1e-144	MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBL	A0A3B5ZR76	0.0	A0A3B5ZR76_WHEAT; Uncharacterized protein
STRING	Traes_1DS_F22A3DB6A.1	0.0	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP649	37	144

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	2e-96	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Yan D, et al. Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development. Plant J., 2015. 82(1): p. 12-24 [PMID:25647350] Zheng M, et al. DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa). New Phytol., 2015. 206(4): p. 1476-90 [PMID:25675970] Chen R, et al. A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58. Mol Plant, 2015. 8(7): p. 1069-89 [PMID:25684654] Hu Y, et al. Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758]