PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1DL_FCDEFA244.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 118aa MW: 13574.8 Da PI: 10.1178 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.3 | 4.8e-15 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd l+ ++++ G+g +W + ++++g++R++k+c++rw++yl Traes_1DL_FCDEFA244.1 14 RGPWSPEEDAMLKAYIEERGTGnNWIALPHKIGLKRCGKSCRLRWLNYL 62 89**********************************************7 PP | |||||||
2 | Myb_DNA-binding | 42.6 | 1.4e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +T+eEd + ++ G++ W+ Ia+ ++ gRt++++k++w++ Traes_1DL_FCDEFA244.1 69 GDFTPEEDSTICKLYISIGSR-WSIIAAQLP-GRTDNDVKNYWNT 111 789******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.957 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.59E-27 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-10 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.1E-14 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.3E-24 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.55E-8 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 21.521 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 1.2E-11 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.6E-12 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.7E-24 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.83E-8 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MGRAPCCDKA TVKRGPWSPE EDAMLKAYIE ERGTGNNWIA LPHKIGLKRC GKSCRLRWLN 60 YLRPNIKHGD FTPEEDSTIC KLYISIGSRW SIIAAQLPGR TDNDVKNYWN TKLKKRLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3zqc_A | 1e-24 | 14 | 117 | 2 | 103 | MYB3 |
3zqc_D | 1e-24 | 14 | 117 | 2 | 103 | MYB3 |
3zqc_G | 1e-24 | 14 | 117 | 2 | 103 | MYB3 |
3zqc_J | 1e-24 | 14 | 117 | 2 | 103 | MYB3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK111788 | 1e-110 | AK111788.1 Oryza sativa Japonica Group cDNA clone:J023093J22, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020188367.1 | 8e-85 | transcription factor MYB36-like | ||||
Swissprot | Q9M2Y9 | 3e-71 | RAX3_ARATH; Transcription factor RAX3 | ||||
TrEMBL | A0A3B5YZ69 | 1e-83 | A0A3B5YZ69_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A452Z2T7 | 2e-83 | A0A452Z2T7_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A452Z2U1 | 5e-84 | A0A452Z2U1_AEGTS; Uncharacterized protein | ||||
STRING | Traes_1BL_02507996C.1 | 2e-84 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP135 | 38 | 412 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49690.1 | 1e-73 | myb domain protein 84 |
Publications ? help Back to Top | |||
---|---|---|---|
|