PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1DL_D25CDC57D.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 167aa MW: 19468.3 Da PI: 10.206 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 75.5 | 4e-24 | 9 | 59 | 1 | 50 |
S---SHHHHHHHHHHHHHHHH.HHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngil.KKAeELSvLCdaevaviifsstgklyeys 50 krien+snrqvtf+kRr+g+ KKA E+ vLCdaev v+ifss gkly++ Traes_1DL_D25CDC57D.1 9 KRIENSSNRQVTFAKRRAGLVxKKAREIGVLCDAEVGVVIFSSAGKLYDFW 59 79*****************966**************************995 PP | |||||||
2 | K-box | 66.3 | 1.1e-22 | 78 | 165 | 1 | 88 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 yq++sgk l+++k++s + e++++kke++n+q e+Rh++Ged++sL+ keL +e++L ++ ++ R+k +++++++ ++ ++ e+e++ Traes_1DL_D25CDC57D.1 78 YQTNSGKILWDEKHKSISAEIDRVKKENDNMQIELRHMKGEDVNSLQPKELIAIEEALTNGQTNLRDKMMDHWKMHRRNEKMLEEEHK 165 89999999************************************************************99999999999888888765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.2E-35 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.497 | 1 | 62 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.19E-27 | 2 | 102 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.44E-36 | 2 | 87 | No hit | No description |
PRINTS | PR00404 | 3.8E-19 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.4E-21 | 10 | 58 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.8E-19 | 39 | 60 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.1E-14 | 89 | 167 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.562 | 91 | 167 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MGRGKIEIKR IENSSNRQVT FAKRRAGLVX KKAREIGVLC DAEVGVVIFS SAGKLYDFWT 60 PKTTFAFAVR LPRILEKYQT NSGKILWDEK HKSISAEIDR VKKENDNMQI ELRHMKGEDV 120 NSLQPKELIA IEEALTNGQT NLRDKMMDHW KMHRRNEKML EEEHKLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 6e-16 | 1 | 93 | 1 | 78 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 6e-16 | 1 | 93 | 1 | 78 | Myocyte-specific enhancer factor 2B |
1tqe_R | 6e-16 | 1 | 93 | 1 | 78 | Myocyte-specific enhancer factor 2B |
1tqe_S | 6e-16 | 1 | 93 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_A | 6e-16 | 1 | 93 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_B | 6e-16 | 1 | 93 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_C | 6e-16 | 1 | 93 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_D | 6e-16 | 1 | 93 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_E | 6e-16 | 1 | 93 | 1 | 78 | Myocyte-specific enhancer factor 2B |
6c9l_F | 6e-16 | 1 | 93 | 1 | 78 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. {ECO:0000269|PubMed:9869408}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB107991 | 1e-162 | AB107991.1 Triticum aestivum WPI1 mRNA for PISTILLATA-like MADS box protein, complete cds. | |||
GenBank | AM502880 | 1e-162 | AM502880.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM14 (WM14 gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020166620.1 | 1e-110 | MADS-box transcription factor 4-like | ||||
Swissprot | Q40703 | 1e-102 | MADS4_ORYSJ; MADS-box transcription factor 4 | ||||
TrEMBL | A0A452Z5T3 | 1e-117 | A0A452Z5T3_AEGTS; Uncharacterized protein | ||||
STRING | Traes_1DL_D25CDC57D.1 | 1e-120 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3434 | 38 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G20240.1 | 4e-60 | MIKC_MADS family protein |