PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1DL_772D1D7DF.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 78aa MW: 9274.65 Da PI: 10.4281 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 88.9 | 5.6e-28 | 2 | 68 | 20 | 87 |
trihelix 20 rlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 r++++ k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+qlea Traes_1DL_772D1D7DF.1 2 RYQEAGPKGPLWEEISAGMRRMGYNRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLEA 68 6788999********************************************8.99***********85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd12203 | 7.99E-18 | 2 | 47 | No hit | No description |
Pfam | PF13837 | 4.4E-19 | 3 | 69 | No hit | No description |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MRYQEAGPKG PLWEEISAGM RRMGYNRSSK RCKEKWENIN KYFKKVKESN KKRPEDSKTC 60 PYFHQLEALY RNKAALGS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specific DNA sequence. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK354426 | 1e-118 | AK354426.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1007E05. | |||
GenBank | AK361507 | 1e-118 | AK361507.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1142F04. | |||
GenBank | AK372713 | 1e-118 | AK372713.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3010E21. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020191229.1 | 2e-48 | trihelix transcription factor GTL1-like isoform X1 | ||||
Refseq | XP_020191230.1 | 8e-49 | trihelix transcription factor GTL1-like isoform X2 | ||||
Swissprot | Q39117 | 2e-39 | TGT2_ARATH; Trihelix transcription factor GT-2 | ||||
TrEMBL | A0A452YIX3 | 5e-50 | A0A452YIX3_AEGTS; Uncharacterized protein | ||||
STRING | MLOC_14207.3 | 7e-49 | (Hordeum vulgare) | ||||
STRING | Traes_1DL_772D1D7DF.1 | 2e-51 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP606 | 38 | 175 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76880.1 | 2e-43 | Trihelix family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|