PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1DL_57F246ADF.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 153aa MW: 17143.6 Da PI: 10.7013 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.2 | 5.7e-16 | 42 | 89 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ed +l +vk++G +W+ + + g+ R++k+c++rw ++l Traes_1DL_57F246ADF.1 42 KGPWTPAEDAILEAYVKKHGVQNWNVVQKDTGLLRCGKSCRLRWANHL 89 79******************************99**********9996 PP | |||||||
2 | Myb_DNA-binding | 24.4 | 6.8e-08 | 95 | 124 | 1 | 31 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartm 31 +g +T+eE+ l+++++ ++G++ W++ a+++ Traes_1DL_57F246ADF.1 95 KGTFTKEEENLIIKLHSKMGNK-WARMAARV 124 799*******************.***99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.81 | 37 | 93 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-22 | 38 | 92 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.0E-13 | 41 | 91 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-14 | 42 | 89 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.79E-24 | 43 | 119 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.50E-10 | 44 | 89 | No hit | No description |
PROSITE profile | PS50090 | 6.597 | 90 | 124 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 4.0E-14 | 93 | 124 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.44 | 94 | 147 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.3E-7 | 95 | 124 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 0.00241 | 97 | 124 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MTRAKSESGR EMPGPDQADL ASRDDDSARE SPRRRAGPQL KKGPWTPAED AILEAYVKKH 60 GVQNWNVVQK DTGLLRCGKS CRLRWANHLR PDLKKGTFTK EEENLIIKLH SKMGNKWARM 120 AARVSSVSSS YFSGSAFIKF CSHASLVRVG FLI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 4e-20 | 20 | 121 | 36 | 136 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 4e-20 | 20 | 121 | 36 | 136 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 2e-20 | 17 | 121 | 2 | 105 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF951900 | 0.0 | JF951900.1 Triticum aestivum clone TaMYB15 R2R3-MYB protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020181615.1 | 5e-85 | transcription factor GAMYB-like isoform X1 | ||||
Refseq | XP_020181616.1 | 5e-85 | transcription factor GAMYB-like isoform X1 | ||||
Refseq | XP_020181617.1 | 5e-85 | transcription factor GAMYB-like isoform X1 | ||||
Refseq | XP_020181618.1 | 5e-85 | transcription factor GAMYB-like isoform X2 | ||||
Swissprot | A2WW87 | 2e-53 | GAM1_ORYSI; Transcription factor GAMYB | ||||
TrEMBL | A0A452ZE56 | 1e-110 | A0A452ZE56_AEGTS; Uncharacterized protein | ||||
STRING | Traes_1DL_57F246ADF.1 | 1e-111 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3947 | 36 | 64 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G32460.2 | 4e-45 | myb domain protein 101 |
Publications ? help Back to Top | |||
---|---|---|---|
|