PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1DL_2714E3604.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 111aa MW: 12800.4 Da PI: 9.7578 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41.2 | 3.7e-13 | 4 | 52 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 +g+W+ eEd+ l++ ++++G g +W + a+t+g+ R++ c+ rw++yl Traes_1DL_2714E3604.1 4 KGKWSREEDDFLKKHIEKYGIGrSWQALAETLGLQRCGRGCRARWLNYL 52 79******************999*************************7 PP | |||||||
2 | Myb_DNA-binding | 33.6 | 9.2e-11 | 59 | 100 | 2 | 45 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 g++T+ E+ ++ + + G+ W+ Ia+ ++ gRt+ +k++w+ Traes_1DL_2714E3604.1 59 GNFTQAEESIICEMYSKRGSC-WSVIAAQLP-GRTDLAVKNYWN 100 89*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.579 | 1 | 56 | IPR017930 | Myb domain |
SMART | SM00717 | 2.6E-8 | 3 | 54 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.49E-26 | 3 | 99 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.0E-21 | 5 | 59 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.91E-7 | 6 | 52 | No hit | No description |
Pfam | PF13921 | 3.1E-11 | 7 | 67 | No hit | No description |
SMART | SM00717 | 2.3E-7 | 57 | 105 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 10.906 | 57 | 107 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.4E-19 | 60 | 101 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.84E-6 | 60 | 100 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MMKKGKWSRE EDDFLKKHIE KYGIGRSWQA LAETLGLQRC GRGCRARWLN YLRPGLKHGN 60 FTQAEESIIC EMYSKRGSCW SVIAAQLPGR TDLAVKNYWN GTXACQPYAQ H |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 8e-24 | 2 | 102 | 25 | 123 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions as regulator of genes affecting cell wall organization and remodeling. Activates genes related to the primary cell wall and represses genes related to the secondary cell wall and expansins. Required for the regulation of longitudinal cell growth in stems, leaves, petioles, roots, flowers and siliques. {ECO:0000269|PubMed:24563287}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014661280.1 | 4e-62 | transcription factor RAX2 | ||||
Swissprot | F4JSU0 | 2e-40 | MYB87_ARATH; Transcription factor MYB87 | ||||
TrEMBL | A0A3B5ZUK7 | 4e-70 | A0A3B5ZUK7_WHEAT; Uncharacterized protein | ||||
STRING | Traes_1DL_2714E3604.1 | 7e-78 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP12228 | 26 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37780.1 | 7e-43 | myb domain protein 87 |
Publications ? help Back to Top | |||
---|---|---|---|
|