PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_1DL_2714E3604.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB

Protein Properties

Length: 111aa MW: 12800.4 Da PI: 9.7578

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_1DL_2714E3604.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	41.2	3.7e-13	4	52	1	48
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 +g+W+ eEd+ l++ ++++G g +W + a+t+g+ R++ c+ rw++yl Traes_1DL_2714E3604.1 4 KGKWSREEDDFLKKHIEKYGIGrSWQALAETLGLQRCGRGCRARWLNYL 52 79****************999***********************7 PP
2	Myb_DNA-binding	33.6	9.2e-11	59	100	2	45
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 g++T+ E+ ++ + + G+ W+ Ia+ ++ gRt+ +k++w+ Traes_1DL_2714E3604.1 59 GNFTQAEESIICEMYSKRGSC-WSVIAAQLP-GRTDLAVKNYWN 100 89*****************.*****.*********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	19.579	1	56	IPR017930	Myb domain
SMART	SM00717	2.6E-8	3	54	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.49E-26	3	99	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.0E-21	5	59	IPR009057	Homeodomain-like
CDD	cd00167	1.91E-7	6	52	No hit	No description
Pfam	PF13921	3.1E-11	7	67	No hit	No description
SMART	SM00717	2.3E-7	57	105	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	10.906	57	107	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	9.4E-19	60	101	IPR009057	Homeodomain-like
CDD	cd00167	3.84E-6	60	100	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 111 aa Download sequence Send to blast
MMKKGKWSRE EDDFLKKHIE KYGIGRSWQA LAETLGLQRC GRGCRARWLN YLRPGLKHGN 60 FTQAEESIIC EMYSKRGSCW SVIAAQLPGR TDLAVKNYWN GTXACQPYAQ H

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	8e-24	2	102	25	123	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that functions as regulator of genes affecting cell wall organization and remodeling. Activates genes related to the primary cell wall and represses genes related to the secondary cell wall and expansins. Required for the regulation of longitudinal cell growth in stems, leaves, petioles, roots, flowers and siliques. {ECO:0000269\|PubMed:24563287}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014661280.1	4e-62	transcription factor RAX2
Swissprot	F4JSU0	2e-40	MYB87_ARATH; Transcription factor MYB87
TrEMBL	A0A3B5ZUK7	4e-70	A0A3B5ZUK7_WHEAT; Uncharacterized protein
STRING	Traes_1DL_2714E3604.1	7e-78	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP12228	26	38

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G37780.1	7e-43	myb domain protein 87

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Fujiwara S, et al. Chimeric repressor analysis identifies MYB87 as a possible regulator of morphogenesis via cell wall organization and remodeling in Arabidopsis. Biotechnol. Lett., 2014. 36(5): p. 1049-57 [PMID:24563287]