PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1BS_060C24872.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 113aa MW: 13008.8 Da PI: 9.9686 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.1 | 7.5e-17 | 2 | 43 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 T+ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++ Traes_1BS_060C24872.1 2 TPHEERLILELHARWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 43 9*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00167 | 4.42E-12 | 1 | 43 | No hit | No description |
PROSITE profile | PS51294 | 24.155 | 1 | 47 | IPR017930 | Myb domain |
SMART | SM00717 | 2.3E-11 | 1 | 45 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.26E-13 | 2 | 50 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.8E-20 | 2 | 44 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.4E-14 | 2 | 42 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MTPHEERLIL ELHARWGNRW SRIARKLPGR TDNEIKNYWR THMRKKAQER KRSVSPSPSS 60 SSVTYQSIQP QTPSIMGIGE QELHGGSSCI TSILKGTPAD MDGYLMDQIW MEI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT009536 | 0.0 | BT009536.1 Triticum aestivum clone wr1.pk0139.g11:fis, full insert mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020201689.1 | 5e-77 | myb-related protein MYBAS2-like isoform X3 | ||||
Refseq | XP_020201690.1 | 5e-77 | myb-related protein MYBAS2-like isoform X3 | ||||
Swissprot | Q4JL76 | 6e-55 | MYBA2_ORYSJ; Myb-related protein MYBAS2 | ||||
TrEMBL | A0A3B6KCK9 | 2e-76 | A0A3B6KCK9_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A3B6KDU0 | 3e-76 | A0A3B6KDU0_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446SS17 | 3e-76 | A0A446SS17_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A446SS82 | 2e-76 | A0A446SS82_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A446SS86 | 5e-76 | A0A446SS86_TRITD; Uncharacterized protein | ||||
STRING | Traes_1BS_060C24872.1 | 6e-79 | (Triticum aestivum) | ||||
STRING | Traes_5AS_7D519210E.2 | 2e-77 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP636 | 37 | 169 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59780.1 | 2e-31 | myb domain protein 59 |
Publications ? help Back to Top | |||
---|---|---|---|
|