PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1BL_736D60ADD.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 108aa MW: 11941.5 Da PI: 8.5108 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.2 | 1.4e-16 | 2 | 45 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg ++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++ Traes_1BL_736D60ADD.1 2 RGCFSQQEEDHIVALHQILGNR-WSQIASHLP-GRTDNEIKNFWNS 45 899*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.151 | 1 | 51 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.25E-14 | 1 | 59 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.5E-13 | 1 | 49 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.4E-21 | 1 | 51 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.5E-14 | 2 | 45 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.23E-11 | 5 | 44 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
KRGCFSQQEE DHIVALHQIL GNRWSQIASH LPGRTDNEIK NFWNSCIKKK LRQQGIDPAT 60 HKPMGATATA ALPDAKEEDR KTLSAAVDGS LAPKQQTVFA PFPVCADY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM066946 | 1e-116 | KM066946.1 Triticum aestivum R2R3-MYB transcription factor (MYB86) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020158685.1 | 2e-69 | myb-related protein Hv33-like | ||||
Swissprot | P20027 | 2e-56 | MYB3_HORVU; Myb-related protein Hv33 | ||||
TrEMBL | A0A3B5Z2T5 | 6e-71 | A0A3B5Z2T5_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446K9K8 | 6e-71 | A0A446K9K8_TRITD; Uncharacterized protein | ||||
STRING | Traes_1BL_736D60ADD.1 | 1e-76 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2327 | 33 | 91 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26660.1 | 2e-32 | myb domain protein 86 |
Publications ? help Back to Top | |||
---|---|---|---|
|