PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1BL_2EDC5C26F.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 133aa MW: 15271.6 Da PI: 8.979 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51 | 3.4e-16 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l+ + ++G g+W++++r g++R++k+c++rw++yl Traes_1BL_2EDC5C26F.1 18 KGLWSPEEDEKLYGHIIRYGVGCWSSVPRLAGLHRCGKSCRLRWLNYL 65 678********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.2E-23 | 11 | 68 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.315 | 13 | 69 | IPR017930 | Myb domain |
SMART | SM00717 | 2.9E-12 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.6E-14 | 18 | 65 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.75E-21 | 20 | 92 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.72E-10 | 21 | 65 | No hit | No description |
PROSITE profile | PS50090 | 4.286 | 66 | 126 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 6.4E-8 | 69 | 92 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MGRPTSGGVQ QQQPKLRKGL WSPEEDEKLY GHIIRYGVGC WSSVPRLAGL HRCGKSCRLR 60 WLNYLRPDLK RGTFSQEEED HIVALHQILG NRSVRPAAQC IRFVFFSHCG ERENDRVSGK 120 IWDNMLMCVL CAC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-15 | 14 | 92 | 23 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK371164 | 1e-108 | AK371164.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2126O15. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020158679.1 | 3e-55 | myb-related protein Hv33-like | ||||
Swissprot | P20027 | 2e-50 | MYB3_HORVU; Myb-related protein Hv33 | ||||
TrEMBL | A0A452ZQQ0 | 2e-68 | A0A452ZQQ0_AEGTS; Uncharacterized protein | ||||
STRING | Traes_1BL_2EDC5C26F.1 | 2e-95 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G01680.3 | 8e-42 | myb domain protein 55 |
Publications ? help Back to Top | |||
---|---|---|---|
|