PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1AS_CA75913B6.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 73aa MW: 8128.15 Da PI: 10.4678 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 51.9 | 1.3e-16 | 11 | 55 | 12 | 56 |
HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 + +Le++F+k+++p++++ + L++++gLt +q+k+WFq rRa+ k Traes_1AS_CA75913B6.1 11 ILALEAAFKKCPHPDETQVANLSRETGLTPQQIKYWFQTRRAQIK 55 789***************************************977 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00389 | 5.3E-11 | 5 | 61 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 8.13E-16 | 9 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 5.65E-14 | 11 | 55 | No hit | No description |
Pfam | PF00046 | 5.2E-14 | 11 | 55 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-15 | 11 | 55 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 13.021 | 14 | 57 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
MDGHRCGARR ILALEAAFKK CPHPDETQVA NLSRETGLTP QQIKYWFQTR RAQIKGSSSN 60 MRPPTQGSSS SDP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010268322.1 | 3e-16 | PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X2 | ||||
Swissprot | Q69T58 | 1e-16 | ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8 | ||||
TrEMBL | A0A452XN11 | 3e-46 | A0A452XN11_AEGTS; Uncharacterized protein | ||||
STRING | Traes_1AS_CA75913B6.1 | 1e-48 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP25104 | 2 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G73360.1 | 2e-18 | homeodomain GLABROUS 11 |
Publications ? help Back to Top | |||
---|---|---|---|
|