PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1AL_51EBF8930.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 182aa MW: 21243.4 Da PI: 10.1376 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.8 | 5.2e-18 | 17 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEde l +av+ + g++Wk++a+ ++ Rt+ qc +rwqk+l Traes_1AL_51EBF8930.1 17 KGGWTPEEDETLRKAVTVFKGKNWKRVAEFFP-DRTEVQCLHRWQKVL 63 688*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 57.8 | 2.5e-18 | 69 | 115 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+ +++ vk++G+ W+ Iar + gR +kqc++rw+++l Traes_1AL_51EBF8930.1 69 KGPWTQEEDDTIIQKVKEHGPTKWSVIARSLH-GRIGKQCRERWHNHL 115 79******************************.*************97 PP | |||||||
3 | Myb_DNA-binding | 39.5 | 1.3e-12 | 121 | 154 | 1 | 36 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt 36 + +WT eE++ lvda++++G++ W+ Ia+ ++ gR Traes_1AL_51EBF8930.1 121 KEAWTFEEEQVLVDAHRMHGNK-WAEIAKLLP-GRI 154 579*******************.*********.996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.265 | 12 | 63 | IPR017930 | Myb domain |
SMART | SM00717 | 4.6E-14 | 16 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-15 | 17 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.59E-18 | 18 | 82 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.2E-24 | 19 | 75 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.86E-12 | 20 | 63 | No hit | No description |
PROSITE profile | PS51294 | 28.642 | 64 | 119 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.42E-27 | 66 | 157 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.1E-16 | 68 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.7E-17 | 69 | 115 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.41E-12 | 71 | 115 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.9E-26 | 76 | 118 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.4E-15 | 119 | 155 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 10.372 | 120 | 169 | IPR017930 | Myb domain |
SMART | SM00717 | 0.0026 | 120 | 167 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-10 | 121 | 154 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.18E-6 | 123 | 153 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
SYSTNIRRIS GPVRRAKGGW TPEEDETLRK AVTVFKGKNW KRVAEFFPDR TEVQCLHRWQ 60 KVLDPELIKG PWTQEEDDTI IQKVKEHGPT KWSVIARSLH GRIGKQCRER WHNHLDPQIR 120 KEAWTFEEEQ VLVDAHRMHG NKWAEIAKLL PGRIDLLVNG LLEILSLGCS AQILWVRPFA 180 AR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 4e-60 | 16 | 155 | 5 | 144 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 4e-60 | 16 | 155 | 5 | 144 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abiotic stress responses (PubMed:17293435, PubMed:19279197). May play a regulatory role in tolerance to salt, cold, and drought stresses (PubMed:17293435). Transcriptional activator that binds specifically to a mitosis-specific activator cis-element 5'-(T/C)C(T/C)AACGG(T/C)(T/C)A-3', found in promoters of cyclin genes such as CYCB1-1 and KNOLLE (AC Q84R43). Positively regulates a subset of G2/M phase-specific genes, including CYCB1-1, CYCB2-1, CYCB2-2, and CDC20.1 in response to cold treatment (PubMed:19279197). {ECO:0000269|PubMed:17293435, ECO:0000269|PubMed:19279197}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by cold, drought and salt stresses. {ECO:0000269|PubMed:17293435}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK363512 | 0.0 | AK363512.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2016D03. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020147038.1 | 1e-103 | uncharacterized protein LOC109732249 | ||||
Swissprot | Q0JHU7 | 5e-87 | MB3R2_ORYSJ; Transcription factor MYB3R-2 | ||||
TrEMBL | A0A3B5Y2W4 | 1e-103 | A0A3B5Y2W4_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446J4T8 | 1e-103 | A0A446J4T8_TRITD; Uncharacterized protein | ||||
STRING | Traes_1AL_51EBF8930.1 | 1e-131 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3099 | 38 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G02320.2 | 1e-87 | myb domain protein 3r-5 |
Publications ? help Back to Top | |||
---|---|---|---|
|