PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_01E24503F.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 71aa    MW: 8138.3 Da    PI: 10.9865
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_01E24503F.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.92.7e-09947947
                           HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           +  ++++ +++G g+W+ I+r   k+Rt+ q+ s+ qky
  Traes_1AL_01E24503F.1  9 HTMFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKY 47
                           678***********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.7152IPR017930Myb domain
TIGRFAMsTIGR015575.2E-13851IPR006447Myb domain, plants
SuperFamilySSF466892.69E-13853IPR009057Homeodomain-like
PfamPF002494.4E-61047IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-61047IPR009057Homeodomain-like
CDDcd001678.83E-71148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 71 aa     Download sequence    Send to blast
MIPLAPPCHT MFLEGLEKYG RGDWRNISRW SVKTRTPTQV ASHAQKYFIR QANAATRGDS  60
KRKSIHDITN P
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519377e-96JF951937.1 Triticum aestivum clone TaMYB54 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020158940.12e-39transcription factor DIVARICATA-like
SwissprotQ8S9H75e-22DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A446J4434e-47A0A446J443_TRITD; Uncharacterized protein
STRINGTraes_1AL_01E24503F.17e-48(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.16e-25MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  3. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]