PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1AL_01E24503F.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 71aa MW: 8138.3 Da PI: 10.9865 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28.9 | 2.7e-09 | 9 | 47 | 9 | 47 |
HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 + ++++ +++G g+W+ I+r k+Rt+ q+ s+ qky Traes_1AL_01E24503F.1 9 HTMFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKY 47 678***********************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.7 | 1 | 52 | IPR017930 | Myb domain |
TIGRFAMs | TIGR01557 | 5.2E-13 | 8 | 51 | IPR006447 | Myb domain, plants |
SuperFamily | SSF46689 | 2.69E-13 | 8 | 53 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.4E-6 | 10 | 47 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-6 | 10 | 47 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.83E-7 | 11 | 48 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 71 aa Download sequence Send to blast |
MIPLAPPCHT MFLEGLEKYG RGDWRNISRW SVKTRTPTQV ASHAQKYFIR QANAATRGDS 60 KRKSIHDITN P |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF951937 | 7e-96 | JF951937.1 Triticum aestivum clone TaMYB54 MYB-related protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020158940.1 | 2e-39 | transcription factor DIVARICATA-like | ||||
Swissprot | Q8S9H7 | 5e-22 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A446J443 | 4e-47 | A0A446J443_TRITD; Uncharacterized protein | ||||
STRING | Traes_1AL_01E24503F.1 | 7e-48 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2895 | 36 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38090.1 | 6e-25 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|