PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1AL_002FAE6E8.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 48aa MW: 5602.22 Da PI: 6.9388 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.9 | 9.9e-18 | 4 | 47 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg ++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++ Traes_1AL_002FAE6E8.1 4 RGCFSQQEEDHIVALHHILGNR-WSQIASHLP-GRTDNEIKNFWNS 47 899*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.577 | 1 | 48 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.24E-14 | 1 | 47 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.2E-8 | 3 | 48 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.4E-16 | 4 | 47 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-20 | 6 | 47 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.72E-10 | 7 | 46 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 48 aa Download sequence Send to blast |
DLKRGCFSQQ EEDHIVALHH ILGNRWSQIA SHLPGRTDNE IKNFWNSC |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK364378 | 8e-70 | AK364378.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2024H18. | |||
GenBank | X70878 | 8e-70 | X70878.1 H.vulgare myb3 mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020186841.1 | 5e-29 | myb-related protein Hv33-like isoform X3 | ||||
Swissprot | P20027 | 5e-28 | MYB3_HORVU; Myb-related protein Hv33 | ||||
TrEMBL | A0A3B5Y571 | 1e-28 | A0A3B5Y571_WHEAT; Uncharacterized protein | ||||
TrEMBL | M7ZL77 | 9e-29 | M7ZL77_TRIUA; Myb-related protein Hv33 | ||||
STRING | TRIUR3_08099-P1 | 1e-29 | (Triticum urartu) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G01680.3 | 4e-23 | myb domain protein 55 |