PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRAES3BF043700070CFD_t1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 126aa MW: 13245.5 Da PI: 4.7914 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 56.2 | 6.9e-18 | 8 | 106 | 238 | 340 |
GRAS 238 vvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaG 323 +v+v++++ad +s+s+++r++ ++++++ lfd+l++++pr+s r E++ +g+ei++vv g+e r e+ ++ er+++ G TRAES3BF043700070CFD_t1 8 LVTVTDEDADQDSPSLATRIAGCFNFHWILFDALDTSAPRDSPRRLEHEAA-VGQEIESVVGDDGTE---RSESGARLAERMRRKG 89 79***********************************************99.**************9...7777778889****** PP GRAS 324 Fkpvplsekaakqakll 340 F v ++e+++++a++ TRAES3BF043700070CFD_t1 90 FAGVGFGEHEVADARAA 106 ************99975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 9.891 | 1 | 120 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 2.4E-15 | 8 | 106 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MASGATGLVT VTDEDADQDS PSLATRIAGC FNFHWILFDA LDTSAPRDSP RRLEHEAAVG 60 QEIESVVGDD GTERSESGAR LAERMRRKGF AGVGFGEHEV ADARAAAMQG ERGGARRGAA 120 RQAAAS |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 0.0 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020154951.1 | 1e-56 | scarecrow-like protein 32 | ||||
TrEMBL | A0A446Q748 | 3e-83 | A0A446Q748_TRITD; Uncharacterized protein | ||||
STRING | MLOC_41071.1 | 9e-58 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP12227 | 32 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49950.1 | 3e-16 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|