PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRAES3BF020100120CFD_t1 | ||||||||
Common Name | TRAES_3BF020100120CFD_c1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 213aa MW: 23506.7 Da PI: 9.0937 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 174.7 | 2.6e-54 | 4 | 133 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 lppGfrFhPtdee+++ yL++k+ + +++ ++i evd++k ePw+Lp+k+k +e+ewyf++++d+ky+tg r+nratk+gyWkat TRAES3BF020100120CFD_t1 4 LPPGFRFHPTDEEIITSYLAPKILNPAFNA-TAIGEVDLNKNEPWELPNKAKMGENEWYFYCQKDRKYPTGIRTNRATKAGYWKAT 88 79*************************999.88***************99999********************************* PP NAM 87 gkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrle 129 gkdke+++ + l+g+kktLvfykgrap+gekt+Wvmheyrle TRAES3BF020100120CFD_t1 89 GKDKEIVNPhcMSMLMGMKKTLVFYKGRAPSGEKTNWVMHEYRLE 133 ********9777788****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.84E-59 | 2 | 168 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.118 | 4 | 167 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.0E-28 | 5 | 132 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 213 aa Download sequence Send to blast |
MLELPPGFRF HPTDEEIITS YLAPKILNPA FNATAIGEVD LNKNEPWELP NKAKMGENEW 60 YFYCQKDRKY PTGIRTNRAT KAGYWKATGK DKEIVNPHCM SMLMGMKKTL VFYKGRAPSG 120 EKTNWVMHEY RLEIGKQSTS GLPTTIANAA SNNVSSKEYV VCRIFHKNTG SGVSSMVSHE 180 DVGTGPGNND QGNGGATTTD KILSMSMRTG GAC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-50 | 2 | 171 | 15 | 169 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-50 | 2 | 171 | 15 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-50 | 2 | 171 | 15 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-50 | 2 | 171 | 15 | 169 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-50 | 2 | 171 | 18 | 172 | NAC domain-containing protein 19 |
3swm_B | 2e-50 | 2 | 171 | 18 | 172 | NAC domain-containing protein 19 |
3swm_C | 2e-50 | 2 | 171 | 18 | 172 | NAC domain-containing protein 19 |
3swm_D | 2e-50 | 2 | 171 | 18 | 172 | NAC domain-containing protein 19 |
3swp_A | 2e-50 | 2 | 171 | 18 | 172 | NAC domain-containing protein 19 |
3swp_B | 2e-50 | 2 | 171 | 18 | 172 | NAC domain-containing protein 19 |
3swp_C | 2e-50 | 2 | 171 | 18 | 172 | NAC domain-containing protein 19 |
3swp_D | 2e-50 | 2 | 171 | 18 | 172 | NAC domain-containing protein 19 |
4dul_A | 2e-50 | 2 | 171 | 15 | 169 | NAC domain-containing protein 19 |
4dul_B | 2e-50 | 2 | 171 | 15 | 169 | NAC domain-containing protein 19 |
Search in ModeBase |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HE996626 | 0.0 | HE996626.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_60191. | |||
GenBank | HG670306 | 0.0 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020191194.1 | 1e-143 | NAC domain-containing protein 100-like | ||||
Swissprot | Q9FLR3 | 7e-78 | NAC79_ARATH; NAC domain-containing protein 79 | ||||
TrEMBL | W5D096 | 1e-159 | W5D096_WHEAT; Uncharacterized protein | ||||
STRING | Traes_3B_9A0FAE972.1 | 1e-160 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1452 | 37 | 121 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G07680.2 | 2e-80 | NAC domain containing protein 80 |
Publications ? help Back to Top | |||
---|---|---|---|
|