PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF020100120CFD_t1
Common NameTRAES_3BF020100120CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 213aa    MW: 23506.7 Da    PI: 9.0937
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF020100120CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.72.6e-5441331129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdee+++ yL++k+ +  +++ ++i evd++k ePw+Lp+k+k +e+ewyf++++d+ky+tg r+nratk+gyWkat
  TRAES3BF020100120CFD_t1   4 LPPGFRFHPTDEEIITSYLAPKILNPAFNA-TAIGEVDLNKNEPWELPNKAKMGENEWYFYCQKDRKYPTGIRTNRATKAGYWKAT 88 
                              79*************************999.88***************99999********************************* PP

                      NAM  87 gkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++    + l+g+kktLvfykgrap+gekt+Wvmheyrle
  TRAES3BF020100120CFD_t1  89 GKDKEIVNPhcMSMLMGMKKTLVFYKGRAPSGEKTNWVMHEYRLE 133
                              ********9777788****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-592168IPR003441NAC domain
PROSITE profilePS5100557.1184167IPR003441NAC domain
PfamPF023652.0E-285132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MLELPPGFRF HPTDEEIITS YLAPKILNPA FNATAIGEVD LNKNEPWELP NKAKMGENEW  60
YFYCQKDRKY PTGIRTNRAT KAGYWKATGK DKEIVNPHCM SMLMGMKKTL VFYKGRAPSG  120
EKTNWVMHEY RLEIGKQSTS GLPTTIANAA SNNVSSKEYV VCRIFHKNTG SGVSSMVSHE  180
DVGTGPGNND QGNGGATTTD KILSMSMRTG GAC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-50217115169NO APICAL MERISTEM PROTEIN
1ut4_B2e-50217115169NO APICAL MERISTEM PROTEIN
1ut7_A2e-50217115169NO APICAL MERISTEM PROTEIN
1ut7_B2e-50217115169NO APICAL MERISTEM PROTEIN
3swm_A2e-50217118172NAC domain-containing protein 19
3swm_B2e-50217118172NAC domain-containing protein 19
3swm_C2e-50217118172NAC domain-containing protein 19
3swm_D2e-50217118172NAC domain-containing protein 19
3swp_A2e-50217118172NAC domain-containing protein 19
3swp_B2e-50217118172NAC domain-containing protein 19
3swp_C2e-50217118172NAC domain-containing protein 19
3swp_D2e-50217118172NAC domain-containing protein 19
4dul_A2e-50217115169NAC domain-containing protein 19
4dul_B2e-50217115169NAC domain-containing protein 19
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE9966260.0HE996626.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_60191.
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020191194.11e-143NAC domain-containing protein 100-like
SwissprotQ9FLR37e-78NAC79_ARATH; NAC domain-containing protein 79
TrEMBLW5D0961e-159W5D096_WHEAT; Uncharacterized protein
STRINGTraes_3B_9A0FAE972.11e-160(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.22e-80NAC domain containing protein 80
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  5. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]