PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRAES3BF019300020CFD_t1 | ||||||||
Common Name | TRAES_3BF019300020CFD_c1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 178aa MW: 20591.2 Da PI: 10.4344 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.6 | 1.4e-08 | 13 | 59 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 r +W +eEd+ + a +l+ + +W+++a++++ gRt+ + +++q TRAES3BF019300020CFD_t1 13 RRPWAKEEDKAFEAALVMLPDHapdRWERVAARLP-GRTPQEAWEHYQ 59 679*****************99*************.****98777777 PP | |||||||
2 | Myb_DNA-binding | 45.7 | 1.5e-14 | 111 | 155 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++eE++l++d+ +++G g+W+ I+r Rt+ q+ s+ qky TRAES3BF019300020CFD_t1 111 PWSEEEHKLFLDGLEKYGRGDWRNISRFAVRSRTPTQVASHAQKY 155 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 7.822 | 9 | 66 | IPR017930 | Myb domain |
SMART | SM00717 | 4.8E-5 | 12 | 64 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.08E-10 | 12 | 61 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.0E-6 | 13 | 59 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-6 | 13 | 60 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.11E-5 | 15 | 53 | No hit | No description |
PROSITE profile | PS51294 | 17.856 | 104 | 160 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.95E-17 | 106 | 161 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.7E-11 | 108 | 158 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 1.4E-16 | 109 | 159 | IPR006447 | Myb domain, plants |
CDD | cd00167 | 6.52E-11 | 111 | 156 | No hit | No description |
Pfam | PF00249 | 5.7E-12 | 111 | 155 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.6E-11 | 111 | 154 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MDFYYQQAGP PARRPWAKEE DKAFEAALVM LPDHAPDRWE RVAARLPGRT PQEAWEHYQA 60 LVADVDLIER GXXXXXXXXX XXXXXXXRAT VASRGRPAGK PRGEERRRGI PWSEEEHKLF 120 LDGLEKYGRG DWRNISRFAV RSRTPTQVAS HAQKYFIRQA NAATRDSKRK SIHDITTP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 5e-13 | 14 | 71 | 9 | 66 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 1e-142 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020158558.1 | 3e-88 | transcription factor DIVARICATA-like | ||||
Swissprot | Q8S9H7 | 1e-46 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A077S5T5 | 1e-111 | A0A077S5T5_WHEAT; Uncharacterized protein | ||||
STRING | EMT13974 | 1e-87 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2895 | 36 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 4e-48 | Homeodomain-like transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|