PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sevir.7G295300.1.p

Organism

Setaria viridis

Taxonomic ID

4556

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria

Family

MYB

Protein Properties

Length: 198aa MW: 21476.2 Da PI: 9.3186

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sevir.7G295300.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.8	1e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv ++k +G g+W++ ++ g+ R++k+c++rw +yl Sevir.7G295300.1.p 14 KGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	59.8	5.8e-19	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eEd+l++++++ lG++ W++Ia +++ gRt++++k++w+++ Sevir.7G295300.1.p 67 RGNFTEEEDDLIIKLHQILGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.3E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.922	9	61	IPR017930	Myb domain
SMART	SM00717	1.2E-13	13	63	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.2E-30	13	108	IPR009057	Homeodomain-like
Pfam	PF00249	1.8E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.89E-11	16	61	No hit	No description
PROSITE profile	PS51294	28.507	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.3E-28	65	116	IPR009057	Homeodomain-like
SMART	SM00717	6.8E-18	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.1E-17	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	8.86E-14	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 198 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TEEEDDLIIK LHQILGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLARG 120 IDPQTHQPLS GAAANAPSSR LQDQLAAARS SCSPQTSGAG HSSDEDSASV PYLGGIDLNL 180 SLSPPSQPSS PVAAVAN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-31	14	116	7	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Sevir.7G295300.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM156905	1e-167	AM156905.1 Zea mays mRNA for transcription factor MYB8 (myb8 gene).
GenBank	EU963911	1e-167	EU963911.1 Zea mays clone 274019 hypothetical protein mRNA, complete cds.
GenBank	HQ858692	1e-167	HQ858692.1 Zea mays clone UT1148 ZmMYB8 transcription factor mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004977234.1	1e-142	myb-related protein Zm38
Swissprot	P81393	2e-90	MYB08_ANTMA; Myb-related protein 308
Swissprot	Q9SZP1	8e-90	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	K3YA56	1e-140	K3YA56_SETIT; Uncharacterized protein
STRING	Si011098m	1e-141	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	3e-92	myb domain protein 4

Link Out ? help Back to Top
Phytozome	Sevir.7G295300.1.p

Publications ? help Back to Top
Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]