PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sevir.5G450300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 172aa MW: 17924.9 Da PI: 6.5097 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 176.2 | 3.2e-55 | 20 | 115 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++ yl+kyre Sevir.5G450300.1.p 20 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDPMRRYLHKYRE 110 89***************************************************************************************** PP NF-YB 93 legek 97 leg++ Sevir.5G450300.1.p 111 LEGDR 115 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.5E-51 | 16 | 122 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.74E-39 | 22 | 128 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.0E-27 | 25 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.8E-17 | 53 | 71 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 56 | 72 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.8E-17 | 72 | 90 | No hit | No description |
PRINTS | PR00615 | 1.8E-17 | 91 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MADHHGQPPG GGGGGAEEIK EQDRLLPIAN VGRIMKQILP PNAKISKEAK ETMQECVSEF 60 ISFVTGEASD KCHKEKRKTV NGDDVCWAFG ALGFDDYVDP MRRYLHKYRE LEGDRAAAAA 120 SSRGGGPPGP DHPSTSGGPG AGAGPGPSGG GGGHFMFGAM DRSDNNSSRP F* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-44 | 19 | 110 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-44 | 19 | 110 | 1 | 92 | Transcription factor HapC (Eurofung) |
5g49_A | 4e-44 | 14 | 110 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sevir.5G450300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU970198 | 1e-143 | EU970198.1 Zea mays clone 342117 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004971188.1 | 1e-123 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | O82248 | 3e-57 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | K3XSH5 | 1e-122 | K3XSH5_SETIT; Uncharacterized protein | ||||
STRING | Si004874m | 1e-123 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 8e-57 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sevir.5G450300.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|