PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G319900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HB-PHD
Protein Properties Length: 1517aa    MW: 165760 Da    PI: 6.2675
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G319900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.51.1e-08763807852
                         -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
            Homeobox   8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                          +  ++ L+ +Fek++yp + ++e LA++lgLt +qV  WF   R
  Sevir.5G319900.1.p 763 GPIVTQKLKVHFEKDPYPGRVTKENLAQELGLTFNQVCRWFSSTR 807
                         5667899**********************************8776 PP

2Homeobox35.51.7e-119741018953
                          HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
            Homeobox    9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53  
                          +   + L+++Fek++yps++++e LA++lgLt +qV+ WF   R+
  Sevir.5G319900.1.p  974 PIVSQKLKAHFEKDPYPSRATKESLAQELGLTFNQVSKWFSATRY 1018
                          556689**********************************98887 PP

3PHD41.72.6e-14428482150
                         SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHT CS
                 PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCke 50 
                         +C++Cg+   + +++++lCdg C++ fH++Cl+++l +e++p g   wlC+ C +
  Sevir.5G319900.1.p 428 FCAICGSkdVTLQNDIILCDGaCDRGFHQNCLKPPLLTEDIPPGdeGWLCPACVC 482
                         7******64445********66********************9999*******87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.4E-15418484IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.7E-14424483IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.163426483IPR019787Zinc finger, PHD-finger
PfamPF006281.5E-11428482IPR019787Zinc finger, PHD-finger
CDDcd155041.01E-28428480No hitNo description
SMARTSM002496.5E-12428481IPR001965Zinc finger, PHD-type
PROSITE patternPS013590429480IPR019786Zinc finger, PHD-type, conserved site
SuperFamilySSF466897.27E-10755808IPR009057Homeodomain-like
SMARTSM003895.1E-9756817IPR001356Homeobox domain
CDDcd000861.15E-9760811No hitNo description
PfamPF000464.2E-6764807IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-10767820IPR009057Homeodomain-like
PROSITE profilePS5007111.742770813IPR001356Homeobox domain
SuperFamilySSF466891.5E-119601020IPR009057Homeodomain-like
PROSITE profilePS5007113.419631023IPR001356Homeobox domain
SMARTSM003896.8E-139651027IPR001356Homeobox domain
CDDcd000866.07E-129721021No hitNo description
PfamPF000465.9E-99721018IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.3E-129781027IPR009057Homeodomain-like
PROSITE patternPS0002709981021IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1517 aa     Download sequence    Send to blast
MVRKGSEVSA SKSYPLRSSH SSGRVLRSAL TKDNKACSDP QNDSAAAQSA VKKRKNGSPS  60
VSPNNSVRML RSASKNKNDA CSEPLNDKTT AKPAAKKRKN ASPLQVGSPS NTVRVLRSAL  120
KNKDEACSER TTNRTAGDPA ANKRKNVSPS KLGSPGSSAR VLRSASKYKD ETCTEPSVEP  180
AADRKKIASP SKVGSPNDTV RVLRSALKNK NEACTEPLND SIVGQPTAKR RKSGSPLKMA  240
SPFSSARVLR STSERKNEAF NEISNDNTAA QPASGKRKGR TPLKTDSPKI GVRVLRSASG  300
KKNEACSEPV NDSTSAQTAV RKRKSCRPSK DRSPKKDYVK ICQRVRYILN RMNYQQSFIQ  360
AYASEGWKGQ SLEKIRPEKE LERAKAEILQ CKLRIREAFR NMDLVLSEGK LEESLFDSAG  420
EISSEDIFCA ICGSKDVTLQ NDIILCDGAC DRGFHQNCLK PPLLTEDIPP GDEGWLCPAC  480
VCKADSIDAL NELQGSKLSI HDSWEKVFPE AASLANGSKQ VVASDLPPDH IEDSDYNPAL  540
AEEDMMNEDR FSAEDDRKGD DLGLPSEDSE DDDFDPAGPD SSEDQKYELN SEESDFTSDS  600
DDFCAEIAKS CGQDEVSASP LLDVLNSTGR MKIRAVGNQS NEEISNHAFI DMELEQGTVL  660
PISSRRQVER LDYKKLYNEA YGKESSKSSD DEEWSGKELL EGSETDSLGE QLQPAKRCSR  720
RAPAGQQNNE HTPQRERLRG SESEQQTEVL RSNGSSSTGR KFGPIVTQKL KVHFEKDPYP  780
GRVTKENLAQ ELGLTFNQVC RWFSSTRHYS RVASAKNEKH QDNHTSENND STNADSMQTH  840
AGVMEKLTAD RSVIVPEKPT MQNNLNQCNK EDMPLSGTEI EMESYGQESS DSSDEEWSAF  900
STPRKSRLQD NETASPVESL LPPKRCSRRT PAREQNNEHT PQSEQLTGSA SEHRTEVLCS  960
NSSSSKASKH HFGPIVSQKL KAHFEKDPYP SRATKESLAQ ELGLTFNQVS KWFSATRYYS  1020
RGAAAKNKKH PGKNTTENDN SLSFDGVEVR EPNIGLMEKP AADINDTISE KLMIQINLNE  1080
DIEEDIPPSQ YTRCEERATM TPTAISTEVG PPGYGPGENF LQVSSRNTSC EQNVIMTPPA  1140
ILREVGPPGY VRGENQGNNA PRNMSCEQGV FTSPTTITRE IGPPGYGPEE NQGSGISWNM  1200
SCEQGVFMSS PTISREAGPP GYGSRENQGS GTSWNTSCEQ GMFINPATIS REAGPPGYGP  1260
GEKHGNGTSP NTSCELRMFT SPTTISREVG LPGNEPGEDQ DNGTSWNMSY KKGVFPTAIE  1320
VVPPGFGPGE NQDYGTARNI RCEQRMYTSP TTIPREVGLP GYGGENQSNG ASWSTCYEQG  1380
VFTSPTAISR EIGPPGYGPG ENQGNITLWT TSCKQRMFAN HTTVSSEGGP PGYSIIENQG  1440
TGGSRNIDLE QRAVVTPGTI SREVFPPGYG PGENQDSGAS GNVGSPQGRS AQKVEFSDEA  1500
RKKAIQRELR RRQKFR*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor involved in the regulation of gibberrelin (GA) signaling. Binds to the 5'-GATC-3' motif of HD16/EL1 promoter. Functions as a positive regulator of GA signaling by suppressing the expression of HD16/EL1, a negative regulator of GA signaling. {ECO:0000269|PubMed:21951842}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.5G319900.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by gibberellin. {ECO:0000269|PubMed:21951842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969941.10.0remodeling and spacing factor 1
SwissprotQ8H9910.0HAZ1_ORYSJ; Homeobox protein HAZ1
TrEMBLK3XDR80.0K3XDR8_SETIT; Uncharacterized protein
STRINGSi000035m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.16e-95Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wen BQ,Xing MQ,Zhang H,Dai C,Xue HW
    Rice homeobox transcription factor HOX1a positively regulates gibberellin responses by directly suppressing EL1.
    J Integr Plant Biol, 2011. 53(11): p. 869-78
    [PMID:21951842]