PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G071600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family NAC
Protein Properties Length: 346aa    MW: 37960.5 Da    PI: 9.3068
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G071600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.31.2e-52191511129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF P+dee++++yLk+kv+++++++ ++i evd++++ePw+L  k+k ++kewyfF  +d+ky+tgkr+nratk gyWkatgkd+e
  Sevir.5G071600.1.p  19 LPPGFRFYPSDEEIITFYLKPKVHQSNFSC-TAIGEVDLNRIEPWELSGKAKMGDKEWYFFYLKDRKYPTGKRTNRATKGGYWKATGKDRE 108
                         79****************************.88**************999999************************************** PP

                 NAM  92 vlskkgel.....vglkktLvfykgrapkgektdWvmheyrle 129
                         ++++ +++     vg+kktLvfykgrap+g+ktdWvmhe+rle
  Sevir.5G071600.1.p 109 IYRAAKKDelpllVGMKKTLVFYKGRAPTGKKTDWVMHEFRLE 151
                         ***8555578999***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-5812186IPR003441NAC domain
PROSITE profilePS5100556.45219186IPR003441NAC domain
PfamPF023652.3E-2620150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGGQKVQPKG MSIKDGLQLP PGFRFYPSDE EIITFYLKPK VHQSNFSCTA IGEVDLNRIE  60
PWELSGKAKM GDKEWYFFYL KDRKYPTGKR TNRATKGGYW KATGKDREIY RAAKKDELPL  120
LVGMKKTLVF YKGRAPTGKK TDWVMHEFRL EGTNKVPCPA SSSTSTTTIK SSSSEDEWVV  180
CRVFDKTTRV KREPALPLFN VAMTGGGIDQ SSISMPMPLQ FSMLSDFTMD PAASYYSTVD  240
ARSLAVPPVM PPLSGMGNIG LQVASTLFGN SMVVAPPMSI YHQMGMGAEG ASSFLGASKS  300
GPSLMVSQKD TGVDHDQANA DEISQMISAN PESVATKDMD GIWKY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-471719215171NO APICAL MERISTEM PROTEIN
1ut4_B2e-471719215171NO APICAL MERISTEM PROTEIN
1ut7_A2e-471719215171NO APICAL MERISTEM PROTEIN
1ut7_B2e-471719215171NO APICAL MERISTEM PROTEIN
4dul_A2e-471719215171NAC domain-containing protein 19
4dul_B2e-471719215171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
UniProtTranscription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269|PubMed:15295076, ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:19694953, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:21303842, ECO:0000269|PubMed:23340744, ECO:0000269|PubMed:23459204, ECO:0000269|PubMed:9351240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.5G071600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:19229035, ECO:0000269|PubMed:19608714, ECO:0000269|PubMed:19694953, ECO:0000269|PubMed:20113437, ECO:0000269|PubMed:20404534, ECO:0000269|PubMed:21511905, ECO:0000269|PubMed:22930749}.
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022682349.10.0protein CUP-SHAPED COTYLEDON 1
SwissprotQ9FKA02e-69NAC92_ARATH; NAC domain-containing protein 92
SwissprotQ9FLJ25e-69NC100_ARATH; NAC domain-containing protein 100
TrEMBLK3XJK10.0K3XJK1_SETIT; Uncharacterized protein
STRINGSi002074m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39610.14e-71NAC domain containing protein 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Manacorda CA, et al.
    Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes.
    Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98
    [PMID:23945002]
  3. Khan M,Rozhon W,Poppenberger B
    The role of hormones in the aging of plants - a mini-review.
    Gerontology, 2014. 60(1): p. 49-55
    [PMID:24135638]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N
    Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast.
    Plant J., 2015. 81(3): p. 377-87
    [PMID:25440717]
  6. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  7. Kim H, et al.
    Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453
    [PMID:30065116]