PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sevir.3G413100.3.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 144aa MW: 15817.6 Da PI: 6.8963 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 51.3 | 3.8e-16 | 107 | 141 | 1 | 36 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrk 36 +ep+YVNaKQy++Il+RRq+Rak+e+e+kl k+rk Sevir.3G413100.3.p 107 EEPVYVNAKQYNAILRRRQSRAKAESERKL-VKGRK 141 69****************************.99998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 0.0012 | 105 | 143 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 20.195 | 106 | 143 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.7E-11 | 108 | 141 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 111 | 131 | IPR018362 | CCAAT-binding factor, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MTSVVHSVSG DHRAEDQHQQ QKQAEPEDQQ EAPVTSSDSQ PTVGTPSDYV APYAPHDMGH 60 AMGQYAYPNI DPYYGSLYAA YGGQPMMHPP LVGMHPTGLP LPTDAIEEPV YVNAKQYNAI 120 LRRRQSRAKA ESERKLVKGR KSK* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sevir.3G413100.3.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU969919 | 1e-156 | EU969919.1 Zea mays clone 337251 nuclear transcription factor Y subunit A-7 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004963231.1 | 1e-100 | nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | K3Z9K5 | 1e-98 | K3Z9K5_SETIT; Uncharacterized protein | ||||
STRING | Si023231m | 2e-99 | (Setaria italica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 2e-24 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sevir.3G413100.3.p |