PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sevir.3G218700.5.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 146aa MW: 15788 Da PI: 5.2896 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 184.6 | 7.5e-58 | 31 | 124 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 vreqdrflPian+srimkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl+kyr Sevir.3G218700.5.p 31 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYR 121 69***************************************************************************************** PP NF-YB 92 ele 94 e+e Sevir.3G218700.5.p 122 EME 124 *98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.0E-53 | 30 | 124 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.02E-39 | 34 | 124 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.4E-28 | 37 | 101 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.8E-23 | 65 | 83 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 68 | 84 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.8E-23 | 84 | 102 | No hit | No description |
PRINTS | PR00615 | 7.8E-23 | 103 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MADAPASPGG GGGSHESGSP RGGGGGGGGG VREQDRFLPI ANISRIMKKA IPANGKIAKD 60 AKETVQECVS EFISFITSEA SDKCQREKRK TINGDDLLWA MATLGFEDYI EPLKVYLQKY 120 REMEVCDIEL FSLCCRYLLL MLNYT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 6e-49 | 30 | 122 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 6e-49 | 30 | 122 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sevir.3G218700.5.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT041097 | 1e-153 | BT041097.1 Zea mays full-length cDNA clone ZM_BFc0174L17 mRNA, complete cds. | |||
GenBank | KJ728339 | 1e-153 | KJ728339.1 Zea mays clone pUT6620 CCAAT-DR1 transcription factor (CADR15) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025806249.1 | 4e-87 | nuclear transcription factor Y subunit B | ||||
Refseq | XP_025806250.1 | 4e-87 | nuclear transcription factor Y subunit B | ||||
Swissprot | P25209 | 1e-64 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | A0A2T7ECR3 | 8e-86 | A0A2T7ECR3_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T8KJ81 | 9e-86 | A0A2T8KJ81_9POAL; Uncharacterized protein | ||||
STRING | Si023400m | 2e-86 | (Setaria italica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 4e-63 | nuclear factor Y, subunit B8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sevir.3G218700.5.p |
Publications ? help Back to Top | |||
---|---|---|---|
|