PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G180600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HB-PHD
Protein Properties Length: 742aa    MW: 81904.1 Da    PI: 4.6396
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G180600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.91.3e-115886271352
                         HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
            Homeobox  13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                         + L e+F+ ++yps++ +e LA++lgLt rqV+ WF  rR
  Sevir.3G180600.1.p 588 QKLHEHFKTEPYPSRSVKENLAEELGLTFRQVSKWFESRR 627
                         6899**********************************99 PP

2PHD43.57e-15216271151
                         SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                 PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                         +C+ Cg+   + +++++lCdg C++ fH++Cl+++l++e++peg   wlC+ C++k
  Sevir.3G180600.1.p 216 FCANCGSkdVTLGNDIILCDGaCDRGFHQNCLNPPLRTEDIPEGdeGWLCPACDCK 271
                         7******64445********66***********************9*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579033.99E-13206274IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.0E-12213270IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.092214271IPR019787Zinc finger, PHD-finger
CDDcd155046.47E-26216268No hitNo description
SMARTSM002491.8E-10216269IPR001965Zinc finger, PHD-type
PfamPF006286.1E-12216271IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590217268IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.601.4E-12566627IPR009057Homeodomain-like
PROSITE profilePS5007114.009573633IPR001356Homeobox domain
SMARTSM003891.4E-10575637IPR001356Homeobox domain
SuperFamilySSF466898.13E-11577633IPR009057Homeodomain-like
CDDcd000861.82E-11578627No hitNo description
PfamPF000464.9E-9588627IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MDKNTPCPIE GNGEVENGVS SSQIPETVEH QVLLSPSKTV QNNMGIRKNY KRAANRGKKG  60
SQGLTDKAYT LRSSDNNVRV LHGTSSSKTT STEHVQTPVQ PAAKRRKRGR PSNKSLSSNK  120
SSTDEFSQIR KRVRYILNRM NYEQSLIEAY ASEGWKNQSL DKIRPEKELE RAKAEILRCK  180
LRIREVFQNL DSLLSKGKID ESLFDSEGEI SCEDIFCANC GSKDVTLGND IILCDGACDR  240
GFHQNCLNPP LRTEDIPEGD EGWLCPACDC KIDCIDVIND LQGSDLSIDD SWEKVFPEAA  300
TMANGSNQDD AFDLPSDDSD DNDFEPNMPE EHVASKEEGS SEEEEDEDGG SDSDDSNFLT  360
SSDSDDSEPL TAKKKVDDLG LPSEDSEDDD YDPAGPDSDK DIQKKESNSD ESDFTSDSDD  420
FCEEIAKTGG HDEVSSPPLP DGKVDDMEKS TSQANTANSN DDHMETEMDQ SVVLPVSGRR  480
QTERLDYKKL YDEAYGEAPS NSSDDEEWSG KSTPRKGHEE SEADSPAGKS SRSTRIVHHS  540
DELTPQSAQK SLHPDSLHGS VDEKHEDLTS NGSNSTSKKG HFGPVINQKL HEHFKTEPYP  600
SRSVKENLAE ELGLTFRQVS KWFESRRHFT RAASSMKGIC PDNHSPENTN SPVATSKQLN  660
EPEGMEMEKP NACGNKDATI SRKVGSPKVG SRKNRRKNAS ASDVRGSKVD SAEDQVPGLD  720
LADKARQKAI QREMMKKKKG R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1692697KNRRKN
Functional Description ? help Back to Top
Source Description
UniProtInteracts with the shrunken (SHR) 26 bp feedback control element.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.3G180600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961485.10.0homeobox protein HOX1A isoform X1
SwissprotP466050.0HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLA0A368QG130.0A0A368QG13_SETIT; Uncharacterized protein
STRINGSi021365m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.12e-86Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain
Publications ? help Back to Top
  1. Bellmann R,Werr W
    Zmhox1a, the product of a novel maize homeobox gene, interacts with the Shrunken 26 bp feedback control element.
    EMBO J., 1992. 11(9): p. 3367-74
    [PMID:1354614]