PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G312300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family NAC
Protein Properties Length: 219aa    MW: 25362.5 Da    PI: 8.3422
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G312300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.23.9e-5461331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd
  Sevir.2G312300.1.p   6 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKCEPWELAeKsLLPSRDPEWYFFGPRDRKYPNGCRTNRATQAGYWKSTGKD 95 
                         79****************************.99**************84335556888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v   +++ +g+kktLv+ykgrap+g +t+Wvmheyr+
  Sevir.2G312300.1.p  96 RRVNY-QNRPIGMKKTLVYYKGRAPQGLRTNWVMHEYRI 133
                         ****9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-634157IPR003441NAC domain
PROSITE profilePS5100559.2796156IPR003441NAC domain
PfamPF023655.7E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MAPADLPPGF RFHPTDEELV NYYLKRKVHG LSIELDIIPE VDLYKCEPWE LAEKSLLPSR  60
DPEWYFFGPR DRKYPNGCRT NRATQAGYWK STGKDRRVNY QNRPIGMKKT LVYYKGRAPQ  120
GLRTNWVMHE YRIEESECEN TMGFQDSYAL CRVFKKNVAF GELQKQKQGE CSSSQAKEKQ  180
EHFTNVGDAG QSSGSNEHGK DNSWLQFISD DVWCNKTK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-55615617165NO APICAL MERISTEM PROTEIN
1ut4_B3e-55615617165NO APICAL MERISTEM PROTEIN
1ut7_A3e-55615617165NO APICAL MERISTEM PROTEIN
1ut7_B3e-55615617165NO APICAL MERISTEM PROTEIN
3swm_A4e-55615620168NAC domain-containing protein 19
3swm_B4e-55615620168NAC domain-containing protein 19
3swm_C4e-55615620168NAC domain-containing protein 19
3swm_D4e-55615620168NAC domain-containing protein 19
3swp_A4e-55615620168NAC domain-containing protein 19
3swp_B4e-55615620168NAC domain-containing protein 19
3swp_C4e-55615620168NAC domain-containing protein 19
3swp_D4e-55615620168NAC domain-containing protein 19
4dul_A3e-55615617165NAC domain-containing protein 19
4dul_B3e-55615617165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.2G312300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1375969e-89AC137596.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 9 clone OSJNBb0031H05, complete sequence.
GenBankAP0055649e-89AP005564.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1228_C03, complete sequence.
GenBankAP0149659e-89AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126179e-89CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957583.11e-165NAC domain-containing protein 86
SwissprotA4VCM07e-88NAC45_ARATH; NAC domain-containing protein 45
TrEMBLK4A1F91e-164K4A1F9_SETIT; Uncharacterized protein
STRINGSi032702m1e-165(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-110NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]