PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G256100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family NAC
Protein Properties Length: 348aa    MW: 39117.9 Da    PI: 6.6114
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G256100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.63.9e-5681371129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeelv++yL+kkv+++k++l +vik+vd+yk+ePwdL++  k+   e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+
  Sevir.1G256100.1.p   8 VPPGFRFHPTDEELVDYYLRKKVASNKIDL-DVIKDVDLYKIEPWDLQEkcKIGMeEQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGR 97 
                         69****************************.9***************952433333556******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk++++ k+ lvg++ktLvfy+grap+g+k+dW+mheyrle
  Sevir.1G256100.1.p  98 DKPIYT-KNCLVGMRKTLVFYRGRAPNGQKSDWIMHEYRLE 137
                         ******.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-626157IPR003441NAC domain
PROSITE profilePS5100560.1438157IPR003441NAC domain
PfamPF023651.1E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MDTAFSHVPP GFRFHPTDEE LVDYYLRKKV ASNKIDLDVI KDVDLYKIEP WDLQEKCKIG  60
MEEQNEWYFF SHKDKKYPTG TRTNRATTAG FWKATGRDKP IYTKNCLVGM RKTLVFYRGR  120
APNGQKSDWI MHEYRLETTE NGTAPEEGWV VCRVFKKRVA TVRRMADGAP CWFDDHVAGF  180
MPPDIGSPRQ LMMHHHHHPT AAAYGGQQLY HCKPELEYHH LLPSQEAFLQ QLPQLESPKP  240
PGAYIAQGSC SLQSSDEASK YAAALQAPME PASYMAATGD DDSVTDWRVL DKFVASQLFS  300
HGDGAPKEAG YSNPAQVFHA EHKQPQEALD YASTSASGGG GEADLWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-50815817166NO APICAL MERISTEM PROTEIN
1ut4_B2e-50815817166NO APICAL MERISTEM PROTEIN
1ut7_A2e-50815817166NO APICAL MERISTEM PROTEIN
1ut7_B2e-50815817166NO APICAL MERISTEM PROTEIN
4dul_A2e-50815817166NAC domain-containing protein 19
4dul_B2e-50815817166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.1G256100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0750930.0KT075093.1 Panicum virgatum secondary wall NAC master switch (SWN8B) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953268.10.0NAC domain-containing protein 7
RefseqXP_004953269.10.0NAC domain-containing protein 7
SwissprotQ9FWX21e-123NAC7_ARATH; NAC domain-containing protein 7
TrEMBLK3YTT30.0K3YTT3_SETIT; Uncharacterized protein
STRINGSi017679m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-112NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]