PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G087600.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HB-PHD
Protein Properties Length: 529aa    MW: 60019.2 Da    PI: 8.2629
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G087600.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.88.6e-09453496952
                         HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
            Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                         ++ +e+L + F++n  p ++ +e L+++l+++ +++  WF+N R
  Sevir.1G087600.3.p 453 PTAVEVLRKSFAENELPPRDVKENLSRELDISFEKIDKWFKNTR 496
                         67899*************************************99 PP

2PHD33.87.5e-12197251150
                         SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHT CS
                 PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCke 50 
                         +C+ C++  s  ++++++C+g Ck+++H kCl+++le++  p +   wlC+ C +
  Sevir.1G087600.3.p 197 MCSTCKSheSFPNNKIIFCEGaCKRTYHEKCLEPPLEKSALPTSshGWLCKFCLC 251
                         6******65555*******966*****************9999999*******86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579038.43E-13190255IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.103.0E-11194252IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.22195252IPR019787Zinc finger, PHD-finger
PfamPF006282.0E-9197251IPR019787Zinc finger, PHD-finger
SMARTSM002491.1E-7197250IPR001965Zinc finger, PHD-type
PROSITE patternPS013590198249IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.601.7E-10438496IPR009057Homeodomain-like
PROSITE profilePS5007111.677442502IPR001356Homeobox domain
SMARTSM003894.7E-8444506IPR001356Homeobox domain
SuperFamilySSF466891.58E-9444511IPR009057Homeodomain-like
CDDcd000863.74E-8446506No hitNo description
PfamPF000462.8E-6453496IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MRSSENKTVC SNSGRSSKRR KETSSELVPV SNRPSRRNAS RQCKHDSPLK RSPRKVRNAT  60
LAKSIKNKYH CSPLKRRRGS DSVAGKVVTG LVARRRKKRK RQNTDEATRL ERRARYFLIK  120
IKLEQNLLDA YSGDGWNGQS REKIKPEKEL QRAKKQIIKC KIAIRDVIRQ LDVCNSTGSF  180
DDPVMPPAEC TDPEHIMCST CKSHESFPNN KIIFCEGACK RTYHEKCLEP PLEKSALPTS  240
SHGWLCKFCL CKVKILEAIN AHLGTNFTVK CHFEDVFKEA TEQIDSEDAL DEDWLSEYSG  300
DEDYDPEENE ASSSCMNSGE EIMSDDSNGS GSPLYSPNDD IPDFISADFN DVEGLCHANL  360
DLGIDSGEDD GAQILTYQRP RRDVDYRRLN EEMFGKIIEN EEQSEDEDWG HDRRKKRRTR  420
AASVQDNSVD GFSNVISDEK TEKKGRKLFR IPPTAVEVLR KSFAENELPP RDVKENLSRE  480
LDISFEKIDK WFKNTRCAAL RDRKAEGNSH NPAPSKSSRS KGKAGISD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17597RRRGSDSVAGKVVTGLVARRRKK
29398RRRKKR
39399RRRKKRK
494100RRKKRKR
595100RKKRKR
6413419RKKRRTR
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.1G087600.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9489540.0EU948954.1 Zea mays clone 391409 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814275.10.0pathogenesis-related homeodomain protein
TrEMBLA0A2T7F1U10.0A0A2T7F1U1_9POAL; Uncharacterized protein
STRINGPavir.Ab00383.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-87pathogenesis related homeodomain protein A