PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400061017 | ||||||||
Common Name | LOC102578412 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 242aa MW: 27609.2 Da PI: 7.2969 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.3 | 2.3e-15 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+ eEd++l+ ++++G +W++ ++ g+ R++k+c++rw +yl PGSC0003DMP400061017 16 KGAWSCEEDLRLITFIQKHGHQNWRSLPKQAGLLRCGKSCRLRWINYL 63 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 53.6 | 5e-17 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E++ ++++++ +G++ W++Ia++++ gRt++++k+ w+++l PGSC0003DMP400061017 69 RGNFTPQEEDTIIKLHQSFGNK-WSKIASHLP-GRTDNEIKNVWNTHL 114 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-23 | 8 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.679 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.36E-30 | 14 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.0E-10 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.0E-14 | 16 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.83E-8 | 18 | 63 | No hit | No description |
PROSITE profile | PS51294 | 24.923 | 64 | 118 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.8E-28 | 67 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-15 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.5E-16 | 69 | 114 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.66E-10 | 71 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 242 aa Download sequence Send to blast |
MGKGRAACCD KSKVKKGAWS CEEDLRLITF IQKHGHQNWR SLPKQAGLLR CGKSCRLRWI 60 NYLRPDLKRG NFTPQEEDTI IKLHQSFGNK WSKIASHLPG RTDNEIKNVW NTHLKKRRLI 120 HSEAKLDDSS CAYNSPSSTS VLSHANTIIH EKEEAKRSCS SSYNASSSLS NLSQVEIISS 180 PNINHVDMDW IFQFNEEPNN YLELTRVLQD DGIIEIPLEC DHVDIWDMLD IMDPPLQTGH 240 E* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 6e-25 | 16 | 117 | 4 | 104 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 6e-25 | 16 | 117 | 4 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 6e-25 | 16 | 117 | 4 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00249 | DAP | Transfer from AT1G79180 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400061017 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by light (PubMed:9839469). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006346031.1 | 0.0 | PREDICTED: myb-related protein Zm1-like | ||||
Swissprot | Q9SA47 | 8e-76 | MYB58_ARATH; Transcription factor MYB58 | ||||
TrEMBL | M1DHZ0 | 1e-179 | M1DHZ0_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400089342 | 1e-180 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16490.1 | 3e-75 | myb domain protein 58 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400061017 |
Entrez Gene | 102578412 |
Publications ? help Back to Top | |||
---|---|---|---|
|