PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400059115 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 127aa MW: 14759.7 Da PI: 9.3638 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 28.4 | 2.8e-09 | 69 | 103 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 + +yp+ e+ LA+++gL+ +q+ +WF N+R ++ PGSC0003DMP400059115 69 NWPYPTDGEKVSLAESTGLDPKQINNWFINQRKRH 103 469*****************************985 PP | |||||||
2 | ELK | 25.7 | 2.6e-09 | 22 | 43 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 E K+ L+ KYsgy+ sLk+ F+ PGSC0003DMP400059115 22 EMKDKLMEKYSGYITSLKHDFC 43 679******************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03789 | 8.1E-10 | 22 | 43 | IPR005539 | ELK domain |
SMART | SM01188 | 4.2E-5 | 22 | 43 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 9.516 | 22 | 42 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 11.612 | 43 | 106 | IPR001356 | Homeobox domain |
SMART | SM00389 | 7.3E-9 | 45 | 110 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.15E-18 | 48 | 114 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.0E-27 | 49 | 106 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 3.04E-12 | 51 | 105 | No hit | No description |
Pfam | PF05920 | 2.6E-17 | 63 | 102 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 81 | 104 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
MGGGGGVNNE QQNDELCRSG SEMKDKLMEK YSGYITSLKH DFCKKNYNKG KLPKEATQIL 60 LNWWTTHYNW PYPTDGEKVS LAESTGLDPK QINNWFINQR KRHWKLPSQN MQFPLMETIY 120 GRHFSQ* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400059115 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975442 | 9e-66 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006344511.1 | 4e-92 | PREDICTED: homeobox protein knotted-1-like 2 | ||||
Swissprot | Q84JS6 | 2e-35 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | M1DDU8 | 2e-90 | M1DDU8_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400087440 | 4e-91 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA753 | 24 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 8e-38 | KNOTTED1-like homeobox gene 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400059115 |
Publications ? help Back to Top | |||
---|---|---|---|
|